PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA09G0100600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ZF-HD
Protein Properties Length: 279aa    MW: 29515 Da    PI: 7.5008
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA09G0100600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.64.7e-3155108458
        ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                         rY+eClkNhA+ +GghavDGCgEfm++ geegt++al+CaAC+CHRnFHR+e+e
  ORGLA09G0100600.1  55 GRYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGTIDALRCAACNCHRNFHRKESE 108
                        59*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-3736109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.9E-3056106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.5E-2956107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.64757106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.13E-20206276IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-33208276IPR009057Homeodomain-like
TIGRFAMsTIGR015651.0E-26215271IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MDFDDHDDGD EEMPPMPVSS SYETPPQHGL AGGGMAPKPP GEIGSRVKGP SCGGGRYREC  60
LKNHAVGIGG HAVDGCGEFM AAGEEGTIDA LRCAACNCHR NFHRKESESL AGEGSPFSPA  120
AVVPYGATPH HQFSPYYRTP AGYLHHHQHH MAAAAAAAAA AAGGHPQRPL ALPSTSHSGR  180
DDGDDLSGMV GPMSAVGPLS GMSLGAGPSG SGSGKKRFRT KFTQEQKDKM LAFAERVGWR  240
IQKHDEAAVQ QFCDEVGVKR HVLKVWMHNN KHTLGKKLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-292162731875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA09G0100600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610854.10.0zinc-finger homeodomain protein 1
SwissprotQ6YXH50.0ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A0E0B4180.0A0A0E0B418_9ORYZ; Uncharacterized protein
TrEMBLI1QPM70.0I1QPM7_ORYGL; Uncharacterized protein
STRINGOGLUM09G13770.10.0(Oryza glumipatula)
STRINGORGLA09G0100600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.16e-62homeobox protein 22
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]