PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA08G0164300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 276aa    MW: 28872.9 Da    PI: 7.2096
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA08G0164300.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.51.3e-3759117462
             zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +  +cprC+s++tkfCyynny++sqPr+fCk CrryWtkGG+lrnvPvGgg+rk+ +ss
  ORGLA08G0164300.1  59 EGDPCPRCESRDTKFCYYNNYNTSQPRHFCKCCRRYWTKGGTLRNVPVGGGTRKKSSSS 117
                        5678**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2660112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.28661115IPR003851Zinc finger, Dof-type
PfamPF027014.6E-3162115IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106399IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MQEQQPETGR RPAQQFATVD LRRPKGYAAA PATPQPGSAA TAAATAGPAA TAAAAAAGEG  60
DPCPRCESRD TKFCYYNNYN TSQPRHFCKC CRRYWTKGGT LRNVPVGGGT RKKSSSSSSS  120
SSSSSAAAAA PAAKRQKTSK KRRVTTPEPL AATTPVLTEA AADSAAKTTT EATSEKKTTT  180
STTTTTPPAP DTTSEITTEV VVPAVEEDSF TDLLQPDSAA VTLGLDFSDY PSITKSLADP  240
DLHFEWPPPA FDMASYWPAG AGFADPDPTA VFLNLP
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence at the MNF1-binding site.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA08G0164300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2413640.0AK241364.1 Oryza sativa Japonica Group cDNA, clone: J065152E11, full insert sequence.
GenBankAP0046200.0AP004620.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0605H02.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650493.10.0dof zinc finger protein MNB1A
SwissprotP385644e-69MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLI1QJP20.0I1QJP2_ORYGL; Uncharacterized protein
STRINGORGLA08G0164300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.19e-29DOF zinc finger protein 1
Publications ? help Back to Top
  1. Yanagisawa S,Izui K
    Molecular cloning of two DNA-binding proteins of maize that are structurally different but interact with the same sequence motif.
    J. Biol. Chem., 1993. 268(21): p. 16028-36
    [PMID:8340424]