PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA08G0158100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ZF-HD
Protein Properties Length: 290aa    MW: 29743.2 Da    PI: 7.0575
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA08G0158100.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.52.7e-3261115459
        ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                        +rY+eClkNhA+ +GghavDGCgEfm++ geeg+++al+CaACgCHRnFHR+e+e+
  ORGLA08G0158100.1  61 ARYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGSIDALRCAACGCHRNFHRKESES 115
                        79*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.7E-2961113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257744.0E-2562115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.1E-3062112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.96363112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.2E-20216287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-32218288IPR009057Homeodomain-like
TIGRFAMsTIGR015657.0E-26226282IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MDFDDHDEGD GDEEMPPMPL SSGYDAPMQP GLGGGGGGVP KPGGGVGGGG GGGGGGGGGG  60
ARYRECLKNH AVGIGGHAVD GCGEFMAAGE EGSIDALRCA ACGCHRNFHR KESESPTGVG  120
PAEPSAVSPA AISAYGASPH HQFSPYYRTP AGYLHHQQHQ MAAAAAAAAA AAAGGYPQRP  180
LALPSTSHSG RDEGDDMSGM VGPMVIGPMV GMSLGSAGPS GSGSGKKRFR TKFTQEQKDK  240
MLAFAERLGW RIQKHDEAAV QQFCEEVCVK RHVLKVWMHN NKHTLGKKAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-292272841875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA08G0158100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1095280.0AK109528.1 Oryza sativa Japonica Group cDNA clone:002-116-C04, full insert sequence.
GenBankAP0046430.0AP004643.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1113_A10.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649557.10.0zinc-finger homeodomain protein 2
SwissprotA2YWA60.0ZHD2_ORYSI; Zinc-finger homeodomain protein 2
SwissprotQ6ZB900.0ZHD2_ORYSJ; Zinc-finger homeodomain protein 2
TrEMBLA0A0E0AWN60.0A0A0E0AWN6_9ORYZ; Uncharacterized protein
TrEMBLI1QJI00.0I1QJI0_ORYGL; Uncharacterized protein
STRINGOGLUM08G19140.10.0(Oryza glumipatula)
STRINGORGLA08G0158100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-60homeobox protein 22
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]