PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA08G0133500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 460aa    MW: 46605.5 Da    PI: 8.1835
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA08G0133500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.1e-32261314255
            G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  ORGLA08G0133500.1 261 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 314
                        9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15258315IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28259315IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23261314IPR006447Myb domain, plants
PfamPF002496.9E-7262313IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MASATSTTPD LSLHISLPSG GAAVGTTAPP GLGNGGAVGG AGGGKAAGGG DPWRRLDGST  60
ASTELSLSTP QQQQERSTSA ADVLPWRLRQ PTAAAASVPV TLPTIPMDGS AAAARAPIRG  120
VPVYSGGGGG GHPFLGGGGG DHRHNRLYNP YHSTAWPSSS PAPAPPPPPA ALDPTTSSLL  180
SPSAYHRMLS STGRLHGVLA DTLRGYAGAA AVSGSIGYGS VAAAAAAAMG GYGGAGAGGG  240
FASSRFMPRL LPASRRSMRA PRMRWTSSLH ARFVHAVELL GGHERATPKS VLELMDVKDL  300
TLAHVKSHLQ MYRTVKSTDK PAAASGPMDG SGSGSGSGDD ELLAGDGRKA TSSGADADRR  360
MSFTEHRSSS EGAASHAGGG GDGDCSSSAV NSDTIRARSN SPRDLWLSSS VCNMDPQHLV  420
TVEDMEPCRS SSLQVSSHEL SSPSLEFTLG RPSWHSIDHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16262316357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14249GGKAAGGG
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA08G0133500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2877880.0AK287788.1 Oryza sativa Japonica Group cDNA, clone: J065172N06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648273.10.0probable transcription factor RL9
SwissprotQ0J2351e-103ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLI1QIT40.0I1QIT4_ORYGL; Uncharacterized protein
STRINGORGLA08G0133500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-30G2-like family protein