PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA08G0063600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 284aa    MW: 30239.6 Da    PI: 6.8477
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA08G0063600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.61.4e-1541101257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        r+R+++++eq+ +Le+ F++   +p ++e +++ + l     + +++V++WFqNrR + ++
  ORGLA08G0063600.1  41 RSRWAPKPEQILILESIFNSgMVNPAKDETARIRRLLerfgAVRDANVFYWFQNRRSRSRR 101
                        89*****************99*************************************997 PP

2Wus_type_Homeobox104.76e-3440102264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        ar+RW+P+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++
  ORGLA08G0063600.1  40 ARSRWAPKPEQILILESIFNSGMVNPAKDETARIRRLLERFGAVRDANVFYWFQNRRSRSRRR 102
                        689**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.64E-1337108IPR009057Homeodomain-like
PROSITE profilePS5007111.67737102IPR001356Homeobox domain
SMARTSM003899.9E-639106IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-840101IPR009057Homeodomain-like
PfamPF000462.4E-1341101IPR001356Homeobox domain
Gene3DG3DSA:1.20.5.6008.6E-4102138IPR012897Potassium channel, voltage dependent, Kv1.4, tandem inactivation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006813Biological Processpotassium ion transport
GO:0048830Biological Processadventitious root development
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0005249Molecular Functionvoltage-gated potassium channel activity
GO:0030955Molecular Functionpotassium ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MDRTATASWE VMSRRGEQQQ QLMMQAPASH NGGSGGGEPA RSRWAPKPEQ ILILESIFNS  60
GMVNPAKDET ARIRRLLERF GAVRDANVFY WFQNRRSRSR RRARQLQQAC GAALHQLPSA  120
AAAAGAGGGG DYYHHHHQPS SSPFLVHGGG GGGVVTSTTA APAVAASGHF LADEVDGGGD  180
DDLFAISRQM GLMARHGGGD HHYSSYADSD ATQLSYQPTG TIQVFINGVA YDVPSGGALD  240
MAGTFGRDAM LVHSSGEVLP VDEHGVLINS LQMGECYYLV SKSI
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA08G0063600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1073050.0AK107305.1 Oryza sativa Japonica Group cDNA clone:002-126-D01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649642.10.0WUSCHEL-related homeobox 10
SwissprotQ6Z3L40.0WOX10_ORYSJ; WUSCHEL-related homeobox 10
TrEMBLI1QGT50.0I1QGT5_ORYGL; Uncharacterized protein
STRINGORGLA08G0063600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.23e-49WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]