PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA07G0240100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 308aa    MW: 33222.5 Da    PI: 12.1068
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA07G0240100.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.53.4e-16136196257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        ++R+++ +eq+++Le+ F++   +p ++e+ ++ ++l    ++ +++V++WFqNr+ + k+
  ORGLA07G0240100.1 136 KPRRNPRPEQIRILEAIFNSgMVNPPRDEIPRIRMQLqdygQVGDANVFYWFQNRKSRSKN 196
                        89*****************99*************************************995 PP

2Wus_type_Homeobox1055e-34135197264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++R +P+peQi+iLe++++sG+++P+++ei ri+++L+ yG+++d+NVfyWFQNrk+R+++k
  ORGLA07G0240100.1 135 PKPRRNPRPEQIRILEAIFNSGMVNPPRDEIPRIRMQLQDYGQVGDANVFYWFQNRKSRSKNK 197
                        578**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.284132197IPR001356Homeobox domain
SuperFamilySSF466895.13E-11133198IPR009057Homeodomain-like
SMARTSM003891.3E-4134201IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.0E-6135199IPR009057Homeodomain-like
CDDcd000863.70E-6135197No hitNo description
PfamPF000467.6E-14136195IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MAALGVPPPP SRAYVSGPLR DDDTFGGDRV RRRRRWLKEQ CPAVIVHGGG RRGGVGGQLE  60
KAGRREEARN SVSGGAKKNR SNGVDKSPTI PHHRPRDPPY PTLPRRHGHR TGGGGGYSLG  120
FRFASAVGEV RVPDPKPRRN PRPEQIRILE AIFNSGMVNP PRDEIPRIRM QLQDYGQVGD  180
ANVFYWFQNR KSRSKNKLRS GGTGHAGLGL GGNRASAPAA AATAHREAVA PSFTLPPILP  240
PQPVQPQQQL VSPVAAPTSL SSSSSDRSSG SSKPARATST QAMSVTAAMD LLSPLRRSAR  300
PRQEQRHV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA07G0240100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646013.11e-105WUSCHEL-related homeobox 13
SwissprotA3BKM21e-131WOX13_ORYSJ; WUSCHEL-related homeobox 13
TrEMBLI1QE590.0I1QE59_ORYGL; Uncharacterized protein
STRINGORGLA07G0240100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26663470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.13e-37homeobox-3