PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA07G0211000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 263aa    MW: 27658.9 Da    PI: 8.4515
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA07G0211000.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.12e-152181257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  ORGLA07G0211000.1 21 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLerfgAVGDANVFYWFQNRRSRSRR 81
                       89*****************99*************************************997 PP

2Wus_type_Homeobox107.39.2e-352083265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
  ORGLA07G0211000.1 20 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLERFGAVGDANVFYWFQNRRSRSRRRQ 83
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.2561782IPR001356Homeobox domain
SuperFamilySSF466897.7E-141888IPR009057Homeodomain-like
SMARTSM003893.9E-61986IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-82189IPR009057Homeodomain-like
PfamPF000463.7E-132181IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MDGGHSPDRH AAAAAAGEPV RSRWTPKPEQ ILILESIFNS GMVNPPKDET VRIRKLLERF  60
GAVGDANVFY WFQNRRSRSR RRQRQLQAQA QAAAAAASSG SPPTASSGGL APGHAGSPAS  120
SLGMFAHGAA GYSSSSSSSW PSSPPSVGMM MGDVDYGGGG DDLFAISRQM GYMDGGGGSS  180
SSAAAGQHQQ QQLYYSCQPA TMTVFINGVA TEVPRGPIDL RSMFGQDVML VHSTGALLPA  240
NEYGILLHSL QMGESYFLVT RSS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in crown root development (PubMed:26307379, PubMed:29740464). Promotes the development of crown roots (both initiation and elongation), main components of the fibrous root system (PubMed:26307379, PubMed:29740464). Regulates the expression of genes required for crown root development, and hormone-responsive genes involved in cytokinin signaling (e.g. RR1, RR2, RR3 and RR4), and auxin signaling (e.g. IAA5, IAA11, IAA23 and IAA31) (PubMed:26307379). Functions dowstream of the auxin biosynthetic genes YUCCA1 in the promotion of crown root development (PubMed:29740464). {ECO:0000269|PubMed:26307379, ECO:0000269|PubMed:29740464}.
UniProtTranscription factor which may be involved in developmental processes. Promotes the development of crown roots (both initiation and elongation), main components of the fibrous root system, by regulating the expression of genes required for crown root development and hormone-responsive genes involved in cytokinin (e.g. RR1, RR2, RR3 and RR4) and auxin (e.g. IAA5, IAA11, IAA23 and IAA31) signaling. {ECO:0000250|UniProtKB:Q0D3I7}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA07G0211000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0635030.0AK063503.1 Oryza sativa Japonica Group cDNA clone:001-116-E11, full insert sequence.
GenBankAK0732320.0AK073232.1 Oryza sativa Japonica Group cDNA clone:J033021B15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645719.11e-131WUSCHEL-related homeobox 11
SwissprotB8B6441e-132WOX11_ORYSI; WUSCHEL-related homeobox 11
SwissprotQ0D3I71e-132WOX11_ORYSJ; WUSCHEL-related homeobox 11
TrEMBLI1QDB80.0I1QDB8_ORYGL; Uncharacterized protein
STRINGORGLA07G0211000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.14e-35WUSCHEL related homeobox 11
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhao Y, et al.
    The Interaction between Rice ERF3 and WOX11 Promotes Crown Root Development by Regulating Gene Expression Involved in Cytokinin Signaling.
    Plant Cell, 2015. 27(9): p. 2469-83
    [PMID:26307379]
  3. Zhang T, et al.
    The YUCCA-Auxin-WOX11 Module Controls Crown Root Development in Rice.
    Front Plant Sci, 2018. 9: p. 523
    [PMID:29740464]