PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA07G0041600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 782aa    MW: 84127.7 Da    PI: 6.4982
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA07G0041600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25e-16466504240
                TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  ORGLA07G0041600.1 466 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 504
                        589**********************************96 PP

2TCR50.93.1e-16552591140
                TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  ORGLA07G0041600.1 552 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCEGCKNTF 591
                        589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17465506IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.33466592IPR005172CRC domain
PfamPF036388.8E-12468503IPR005172CRC domain
SMARTSM011141.7E-17552593IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.1E-12554590IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MDTPDRAAAA APAADSPLFS FIDSLSPIEP LKSTYSASSI QAYQSLNITS ISSIFTSPHD  60
NAQKESKLSK SSFAEFSESE VCADESDKNK PSKSSNAVRL FACTSTLTQA THKITSSVSE  120
GTVGPPEGSN DLPQPGQFDS GSPDHNTTPC HGVRSDLKQG KCRKLQAFQT AKTNTSEKRK  180
CLFSTEVQLM DGCQPEKLND EILGCDWDDL ISATSGELIA YDEDHKGVQL AVSNSESCGF  240
LLSKLTGDGD ISDRTHPSSS TQTYYRELLM DEDQTENAQL VPDGEKNIST EEIQDNLYEA  300
NGSIPTGYKV ETQQQRGMRR RCLVFEAAGY SNRIVQKESV MDLSVSTCKG KSPVQNHSNP  360
GKTPSPRVLR GIGLHLNALA LTSKDKMICQ DPMSSLVLSS ATQQEAHGKM LSAGENFIHP  420
GGELLELQMD DDCSAGVFLG NDHDSSQSNS PQKKRRKSDN GDDGEACKRC SCKKSKCLKL  480
YCECFAAGVY CSEPCSCQGC LNKPIHEEIV LSTRKQIEFR NPLAFAPKVI RMSDAGQDIT  540
GEDPNNTPAS ARHKRGCNCK KSSCLKKYCE CYQGGVGCSS NCRCEGCKNT FGKRDAAVST  600
EAEEMKQGGE EAENCGKEKE NDLQKANAQS EDHPFLELVP ITPPFDVSSS LLKPPNFSSA  660
KPPRPTKARS NSSRSSSKAP GAVHSQKFSK IANSGLNEEM PDILRDDASP GNCVKTSSPN  720
GKRVSPPHNA LSVSPSRKGG RKLILKSIPS FPSLIGDASS GSSMNSTESA FNTASPLALG  780
PS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1646858912120Protein lin-54 homolog
5fd3_B1e-1646858912120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1452456KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA07G0041600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658970.0AK065897.1 Oryza sativa Japonica Group cDNA clone:J013048O08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646690.10.0protein tesmin/TSO1-like CXC 2
TrEMBLI1Q8H40.0I1Q8H4_ORYGL; Uncharacterized protein
STRINGORGLA07G0041600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-83TESMIN/TSO1-like CXC 2