PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA07G0021600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 968aa    MW: 106889 Da    PI: 8.7719
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA07G0021600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.23.7e-08287379147
                        TSSS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrwqk 46 
                        +++W+  E e+l++++kq   +                                              +W++Ia++   gR++ +c srw++
  ORGLA07G0021600.1 287 KQPWSDVEKEKLAKGIKQQYQEalilnsinngsstgdfsavdmayaltntagnfevtpeslrsvlpliNWNKIAAMYLPGRSGAECESRWLN 378
                        79****************99999***************************************************99888************9 PP

                        H CS
    Myb_DNA-binding  47 y 47 
                        +
  ORGLA07G0021600.1 379 F 379
                        7 PP

2Myb_DNA-binding29.41.8e-09387431246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        ++WT+ E+++l+  v+q G+++W  Ia t+g++Rt+ qc  r+q 
  ORGLA07G0021600.1 387 NAWTAREEKRLILTVQQQGMNNWINIAVTLGTHRTPFQCLVRYQR 431
                        68**************************************99995 PP

3Myb_DNA-binding43.47.9e-14441484348
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         W +eEd++l  av+ +G++ W ++++ m  gRt++qc +rw+k l
  ORGLA07G0021600.1 441 DWAEEEDLQLQAAVNTFGTN-WQLVSASMD-GRTGNQCSNRWRKTL 484
                        6*****************99.*********.************975 PP

4Myb_DNA-binding513.3e-16492537248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        grW+ +Ed++l  avk++G+g+W++Ia+ ++ gRt  qc +rw+++l
  ORGLA07G0021600.1 492 GRWSLDEDKRLMVAVKLFGSGSWNKIAQFIP-GRTQSQCNERWRNVL 537
                        8******************************.************986 PP

5Myb_DNA-binding31.44.3e-10544588247
                        SSS-HHHHHHHHHHHHHTTTT-HHHHH.HHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIa.rtmgkgRtlkqcksrwqky 47 
                        g W +eEd +l+  v ++G+  W++Ia ++++ +Rt+++c  rw+k+
  ORGLA07G0021600.1 544 GEWRPEEDSILLASVDEFGPC-WSKIAgAKIP-HRTDNMCLRRWRKL 588
                        68*****************88.****945777.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.4282380IPR017877Myb-like domain
SMARTSM007171.2E-5286382IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-7287319IPR009057Homeodomain-like
CDDcd001670.00133351379No hitNo description
SuperFamilySSF466894.04E-5355394IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-7355400IPR009057Homeodomain-like
PROSITE profilePS5129410.749381437IPR017930Myb domain
SuperFamilySSF466891.69E-21385480IPR009057Homeodomain-like
SMARTSM007176.6E-4385435IPR001005SANT/Myb domain
PfamPF002497.0E-6387431IPR001005SANT/Myb domain
CDDcd001671.18E-4388433No hitNo description
Gene3DG3DSA:1.10.10.602.3E-10401444IPR009057Homeodomain-like
SMARTSM007171.2E-11438486IPR001005SANT/Myb domain
PfamPF002493.6E-12441483IPR001005SANT/Myb domain
PROSITE profilePS500909.721442484IPR017877Myb-like domain
CDDcd001672.22E-9442484No hitNo description
Gene3DG3DSA:1.10.10.602.6E-14445487IPR009057Homeodomain-like
PROSITE profilePS5129419.971485541IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-18488539IPR009057Homeodomain-like
SuperFamilySSF466895.99E-26490585IPR009057Homeodomain-like
SMARTSM007173.0E-12490539IPR001005SANT/Myb domain
PfamPF002492.9E-15492537IPR001005SANT/Myb domain
CDDcd001671.49E-11493537No hitNo description
Gene3DG3DSA:1.10.10.603.8E-15540593IPR009057Homeodomain-like
SMARTSM007171.9E-8542591IPR001005SANT/Myb domain
PfamPF002493.3E-8544588IPR001005SANT/Myb domain
PROSITE profilePS5129413.267544593IPR017930Myb domain
CDDcd001675.51E-9545588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 968 aa     Download sequence    Send to blast
MDFYSDDSDP DIDEDLQRDL DALRQSCILS GNDPDAAVAQ VSACLAAPAA AAGAEVNGSS  60
DDEEEDEDLA LVRSIRENLL LNKASPSSPL PRPICAWPPS DSEDDEDDLE TLRAIQRRFS  120
HYHSGTSSGS EMNTKTEASK EGSGDIFGNE LDEEFDVEKH NKEATTRTGF PKAALLLVDA  180
LKKNRACQKF IRRKMITIEA KIEENKDLRD RVKCLLDYQL SCRKAFGKIL CQKEDPRVRL  240
ISSRKPCAQS TKNKDKKTPA LFLGPADNPH VSKYKMVLKQ LPMSLQKQPW SDVEKEKLAK  300
GIKQQYQEAL ILNSINNGSS TGDFSAVDMA YALTNTAGNF EVTPESLRSV LPLINWNKIA  360
AMYLPGRSGA ECESRWLNFD DPLINHNAWT AREEKRLILT VQQQGMNNWI NIAVTLGTHR  420
TPFQCLVRYQ RSLNHCILNK DWAEEEDLQL QAAVNTFGTN WQLVSASMDG RTGNQCSNRW  480
RKTLNPERSR VGRWSLDEDK RLMVAVKLFG SGSWNKIAQF IPGRTQSQCN ERWRNVLDPD  540
IDLGEWRPEE DSILLASVDE FGPCWSKIAG AKIPHRTDNM CLRRWRKLCQ DKLPSVKAAQ  600
QIKKSILQCN FVDRETERPA IGPSDLMPLV RSKVDGSDEN TVSAKVRKPR KRSRIPCEDN  660
VLPGDTSNSS PSMNLPLSES IDAEAAVNTT TANSKKKPSR SRSKKQTDEN LAVCDVNNSS  720
NCSSGARKRK RSITDNKVVQ KKMKGSISGD NEAVVETVGT ISADNEVATK RKTGSTSVGE  780
EGTTKKTTRG SLSGQGEVNK RMRGSISGVQ KGATKQRMRG SVSTDNHGAV MKSKRAPSRK  840
SAKENSKADS MANAAFGSDL PTVASEDRDA DNGNVKNGRL KSMPRPKQIN MTEGSADKFS  900
TSTRLADCMS FGRINGSSRV ARHLCVSVKP LSNMIQSNGP SDVSAKDPTS TGTDPTSVEN  960
SNTALNLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-263585938159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-263585938159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0654520.0AK065452.1 Oryza sativa Japonica Group cDNA clone:J013025M19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647432.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647433.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647435.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647436.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647437.10.0PREDICTED: myb-like protein L isoform X1
TrEMBLI1Q7X40.0I1Q7X4_ORYGL; Uncharacterized protein
STRINGORGLA07G0021600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-146myb domain protein 4r1