PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA06G0286500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 229aa    MW: 23725.3 Da    PI: 9.4724
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA06G0286500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.85e-384298662
             zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        +cprC+s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +ss
  ORGLA06G0286500.1 42 DPCPRCESRDTKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGGSRKSSTSS 98
                       57**************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-234190IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7054296IPR003851Zinc finger, Dof-type
PfamPF027012.6E-324396IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MQEAGRRPAP QFAGVDLRRP KGYPAAAQLT PAAEEAAAGV GDPCPRCESR DTKFCYYNNY  60
NTSQPRHFCK SCRRYWTKGG SLRNVPVGGG SRKSSTSSSS SSAAASSSSS PSSPAKSPKR  120
SKNSKRRRVS PPPPQPAPTP PPPTTADAAD VAAPTAPEAT TKKAPEDLTA AAATQPAVAL  180
GLGVADGGGG GKEHLDTSPF EWPSGCDLGP YWPTGVFADT DPSLFLNLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124128KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence at the MNF1-binding site.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00672SELEXTransfer from GRMZM2G009406Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA06G0286500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610919.11e-95dof zinc finger protein MNB1A
SwissprotP385646e-56MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLI1QPT21e-161I1QPT2_ORYGL; Uncharacterized protein
STRINGORGLA06G0286500.11e-162(Oryza glaberrima)
STRINGORGLA09G0106100.11e-162(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.15e-26DOF zinc finger protein 1
Publications ? help Back to Top
  1. Yanagisawa S,Izui K
    Molecular cloning of two DNA-binding proteins of maize that are structurally different but interact with the same sequence motif.
    J. Biol. Chem., 1993. 268(21): p. 16028-36
    [PMID:8340424]