PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA06G0102600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 283aa    MW: 28384.3 Da    PI: 7.4335
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA06G0102600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.82.4e-382581460
             zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                       ++++cprCds+ntkfCyynny+lsqPr+fCkaCrryWtkGG lrnvPvGgg+rk k+
  ORGLA06G0102600.1 25 EEVRCPRCDSSNTKFCYYNNYNLSQPRHFCKACRRYWTKGGLLRNVPVGGGCRKPKR 81
                       6789**************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.9E-332681IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0872781IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-262881IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MQEFHSVPGL AGRLFGGAAA VAAVEEVRCP RCDSSNTKFC YYNNYNLSQP RHFCKACRRY  60
WTKGGLLRNV PVGGGCRKPK RPAPLPSSSF TGGGGGGGGG CGHRDSKSAR SAGGGGDGSG  120
STASATATPA AAPASSNTLS AAVSQPSSVD ALSPPPAPMF ADQATAFASL FAPPPPPPSQ  180
ALPAFASFTA QPKAEEDVAD APALAATEQH RSSSAASFAA HSISPPFAAA RSSDGPAAAA  240
AAAAADWAPP TAVLDAGMFD LAGDTSYWNA ASWTDHDGTI YLP
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA06G0102600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047910.0AP004791.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0491D10.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641761.11e-116dof zinc finger protein 4-like
TrEMBLI1Q1L30.0I1Q1L3_ORYGL; Uncharacterized protein
STRINGORGLA06G0102600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-32OBF binding protein 4