PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA06G0016600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 612aa    MW: 65499.6 Da    PI: 6.5151
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA06G0016600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS398.28.4e-1222175891374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalklfsevs 88 
                        lv++L++cA+ +s+g++e+a+ +Larl e+asp+g +pm+R+aayfteALa r++r++++++++ pp+e + +     ++ ++al++++ ++
  ORGLA06G0016600.1 217 LVRALTACADSLSAGNHEAANYYLARLGEMASPAGpTPMHRVAAYFTEALALRVVRMWPHMFDIGPPRELTGDAfggGDDDAMALRILNAIT 308
                        6899*******************************************************************9889999************** PP

               GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                        Pi++f h+t N+ +l+++eg+ervH+iDfdi+qGlQWp Llq+La+R+ +p+++RiTgvg+    s++el+etg rLa++A++lg+ fef++
  ORGLA06G0016600.1 309 PIPRFLHFTLNERLLREFEGHERVHVIDFDIKQGLQWPGLLQSLAARAVPPAHVRITGVGE----SRQELQETGARLARVAAALGLAFEFHP 396
                        *************************************************************....9************************** PP

               GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.nsesFlerflealeyysalfdsl 271
                         v++rled++l++L+vk+gE++aVn+vl++hrll+++++l++    +L l +s+ ++++ + e+e    ns+++ +rf++al+yy+a fd++
  ORGLA06G0016600.1 397 -VVDRLEDVRLWMLHVKRGECVAVNCVLAMHRLLRDDAALTD----FLGLARSTGATILLLGEHEGGGlNSGRWEARFARALRYYAAAFDAV 483
                        .7************************************9999....*******************8777*********************** PP

               GRAS 272 .eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee.aGFkpvplsekaakqaklllrkvksdgyrveee..sgslv 359
                         +a+lp++s +r+k E++ ++rei+n+va eg er+erhe+++ Wr+r+e+  GFk++ ++e++a+q +++ r+++ d y+v+ +   ++l+
  ORGLA06G0016600.1 484 dAAGLPEASPARAKAEEM-FAREIRNAVAFEGPERFERHESFAGWRRRMEDgGGFKNAGIGEREAMQGRMIARMFGPDKYTVQAHggGEALT 574
                        9999**************.*******************************9679**********************888****885455677 PP

               GRAS 360 lgWkdrpLvsvSaWr 374
                        l W d+pL++v+aW+
  ORGLA06G0016600.1 575 LRWLDQPLYTVTAWT 589
                        **************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.99191567IPR005202Transcription factor GRAS
PfamPF035142.9E-119217589IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MLAGCSFSSS RHQMSTAQRF DILPCGFSKR GSRGDGAAPR VAGDARSGAT TCSFRTHPAP  60
PVTQSVSWGA KPEPGGNGNG AHRAVKRAHD EDAVEEYGPI VRAKRTRMGG DGDEVWFHQS  120
IAGTMQATAA GEGEEAEEEK VFLVPSAAAF PHGMAAAGPS LAAAKKEEYS KSPSDSSSSS  180
GTDGGSSAMM PPPQPPEFDA RNGVPAPGQA EREALELVRA LTACADSLSA GNHEAANYYL  240
ARLGEMASPA GPTPMHRVAA YFTEALALRV VRMWPHMFDI GPPRELTGDA FGGGDDDAMA  300
LRILNAITPI PRFLHFTLNE RLLREFEGHE RVHVIDFDIK QGLQWPGLLQ SLAARAVPPA  360
HVRITGVGES RQELQETGAR LARVAAALGL AFEFHPVVDR LEDVRLWMLH VKRGECVAVN  420
CVLAMHRLLR DDAALTDFLG LARSTGATIL LLGEHEGGGL NSGRWEARFA RALRYYAAAF  480
DAVDAAGLPE ASPARAKAEE MFAREIRNAV AFEGPERFER HESFAGWRRR MEDGGGFKNA  540
GIGEREAMQG RMIARMFGPD KYTVQAHGGG EALTLRWLDQ PLYTVTAWTP AGDGAGGSTV  600
SASTTASHSQ QS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A5e-6122459025379Protein SCARECROW
5b3h_D5e-6122459025379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as positivie regulator of brassinosteroid (BR) signaling (PubMed:19220793, PubMed:22685166). Functions downstream of BRI1 and GSK2 to modulate BR responses. Acts as a direct target of GSK2 kinase to mediate BR responses (PubMed:22685166). Involved in feedback inhibition of BR biosynthetic genes. Repressed by BZR1 (PubMed:19220793). {ECO:0000269|PubMed:19220793, ECO:0000269|PubMed:22685166}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA06G0016600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269|PubMed:19220793}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0011680.0AP001168.1 Oryza sativa Japonica Group genomic DNA, chromosome 6, clone:P0425F02.
GenBankAP0028380.0AP002838.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0038F22.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025881992.10.0protein DWARF AND LOW-TILLERING-like
SwissprotQ9LWU90.0DLT_ORYSJ; Protein DWARF AND LOW-TILLERING
TrEMBLI1PZ540.0I1PZ54_ORYGL; Uncharacterized protein
STRINGORGLA06G0016600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-117GRAS family protein
Publications ? help Back to Top
  1. Tong H,Chu C
    Roles of DLT in fine modulation on brassinosteroid response in rice.
    Plant Signal Behav, 2009. 4(5): p. 438-9
    [PMID:19816111]
  2. Li W, et al.
    Identification and characterization of dwarf 62, a loss-of-function mutation in DLT/OsGRAS-32 affecting gibberellin metabolism in rice.
    Planta, 2010. 232(6): p. 1383-96
    [PMID:20830595]
  3. Tong H, et al.
    DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice.
    Plant Cell, 2012. 24(6): p. 2562-77
    [PMID:22685166]
  4. Zhang C,Bai MY,Chong K
    Brassinosteroid-mediated regulation of agronomic traits in rice.
    Plant Cell Rep., 2014. 33(5): p. 683-96
    [PMID:24667992]
  5. Yang C,Shen W,He Y,Tian Z,Li J
    OVATE Family Protein 8 Positively Mediates Brassinosteroid Signaling through Interacting with the GSK3-like Kinase in Rice.
    PLoS Genet., 2016. 12(6): p. e1006118
    [PMID:27332964]