PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA06G0010200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 356aa    MW: 38651 Da    PI: 8.993
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA06G0010200.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.31.5e-2497141145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  ORGLA06G0010200.1  97 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 141
                        79****************************************986 PP

2QLQ58.12.6e-202458236
                QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                        FTaaQ+++L++Q+l+yKyL+a++PvP +Ll++i+
  ORGLA06G0010200.1 24 VFTAAQWAELEQQALIYKYLVAGVPVPGDLLLPIR 58
                       5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.6E-102359IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.1872459IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.6E-142558IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.34697141IPR014977WRC domain
PfamPF088794.1E-2198140IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MLSSSPSAAA PGIGGYQPQR GAAVFTAAQW AELEQQALIY KYLVAGVPVP GDLLLPIRPH  60
SSAAATYSFA NPAAAPFYHH HHHPSLSYYA YYGKKLDPEP WRCRRTDGKK WRCSKEAHPD  120
SKYCERHMHR GRNRSRKPVE SKTAAPAPQS QPQLSNVTTA THDTDAPLPS LTVGAKTHGL  180
SLGGAGSSQF HVDTPSYGSK YSLGAKADVG ELSFFSGASG NTRGFTIDSP TDSSWHSLPS  240
SVPPYPMSKP RDSGLLPGAY SYSHLEPSQE LGQVTIASLS QEQERRSFGG GAGGMLGNVK  300
HENQPLRPFF DEWPGRRDSW SEMDEERSNQ TSFSTTQLSI SIPMPRCGSP ISLRLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1035080.0AK103508.1 Oryza sativa Japonica Group cDNA clone:J033131E19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641602.10.0PREDICTED: growth-regulating factor 5 isoform X1
SwissprotQ6AWY40.0GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLI1PYZ00.0I1PYZ0_ORYGL; Uncharacterized protein
STRINGORGLA06G0010200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110462431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-26growth-regulating factor 5