PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA05G0234100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ZF-HD
Protein Properties Length: 254aa    MW: 27701.8 Da    PI: 8.6182
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA05G0234100.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.59.9e-314295358
        ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                       +vrY+eCl+NhAa++Ggh+vDGCgEfmp +g+   a+alkCaACgCHR+FHR++  
  ORGLA05G0234100.1 42 EVRYHECLRNHAAAMGGHVVDGCGEFMPMPGDA--ADALKCAACGCHRSFHRKDDG 95
                       79***************************8876..9*****************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-234393IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.6E-264393IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.9E-264493IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.2574593IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.48E-20159229IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-31160230IPR009057Homeodomain-like
TIGRFAMsTIGR015651.2E-26171227IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MEFRGHDEPV DEMGVAYGRT PPSSSSSPAA SASAGNGAGA AEVRYHECLR NHAAAMGGHV  60
VDGCGEFMPM PGDAADALKC AACGCHRSFH RKDDGQQQQQ LRLLIPSPPT PRVPLLMPPP  120
PQPHPHPQHP YLHPPFPYHH TPSGSGGTTT ESSSEERGPP SSSAAAAQGR RKRFRTKFTP  180
EQKEQMLAFA ERVGWRMQKQ DEALVEQFCA QVGVRRQVFK VWMHNNKSSI GSSGGGGSRR  240
QPQEQQSQQQ QQQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-281722341880ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA05G0234100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0078580.0AC007858.1 Oryza sativa (japonica cultivar-group) chromosome 5 clone BAC 10A19I, complete sequence.
GenBankAC1209880.0AC120988.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0017N18, complete sequence.
GenBankAK1113500.0AK111350.1 Oryza sativa Japonica Group cDNA clone:002-181-G06, full insert sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639557.11e-123zinc-finger homeodomain protein 6
SwissprotB8AX531e-124ZHD6_ORYSI; Zinc-finger homeodomain protein 6
TrEMBLI1PY930.0I1PY93_ORYGL; Uncharacterized protein
STRINGORGLA05G0234100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69600.13e-34zinc finger homeodomain 1