PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA05G0223800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 514aa    MW: 54477 Da    PI: 6.8977
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA05G0223800.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.43.7e-1670129256
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                        ++R+++ +eq+++Le  F++   +p ++e++++  +l    ++ +++V++WFqNr+ + k
  ORGLA05G0223800.1  70 KPRWNPRPEQIRILEGIFNSgMVNPPRDEIRRIRLQLqeygQVGDANVFYWFQNRKSRTK 129
                        89*****************99*************************************99 PP

2Wus_type_Homeobox107.76.8e-3569131264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe +++sG+++P+++ei+ri+ +L+eyG+++d+NVfyWFQNrk+R ++k
  ORGLA05G0223800.1  69 PKPRWNPRPEQIRILEGIFNSGMVNPPRDEIRRIRLQLQEYGQVGDANVFYWFQNRKSRTKNK 131
                        689**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-1164136IPR009057Homeodomain-like
PROSITE profilePS5007110.07466131IPR001356Homeobox domain
SMARTSM003895.8E-668135IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-669134IPR009057Homeodomain-like
CDDcd000861.05E-669131No hitNo description
PfamPF000468.4E-1470129IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MASPNRHWPS MFRSNLACNI QQQQQPDMNG NGSSSSSFLL SPPTAATTGN GKPSLLSSGC  60
EEGTRNPEPK PRWNPRPEQI RILEGIFNSG MVNPPRDEIR RIRLQLQEYG QVGDANVFYW  120
FQNRKSRTKN KLRAAGHHHH HGRAAALPRA SAPPSTNIVL PSAAAAAPLT PPRRHLLAAT  180
SSSSSSSDRS SGSSKSVKPA AAALLTSAAI DLFSPAPAPT TQLPACQLYY HSHPTPLARD  240
DQLITSPESS SLLLQWPASQ YMPATELGGV LGSSSHTQTP AAITTHPSTI SPSVLLGLCN  300
EALGQHQQET MDDMMITCSN PSKVFDHHSM DDMSCTDAVS AVNRDDEKAR LGLLHYGIGV  360
TAAANPAPHH HHHHHLASPV HDAVSAADAS TAAMILPFTT TAAATPSNVV ATSSALADQL  420
QGLLDAGLLQ GGAAPPPPSA TVVAVSRDDE TMCTKTTSYS FPATMHLNVK MFGEAAVLVR  480
YSGETVLVDD SGVTVEPLQQ GATYYVLVSE EAVH
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA05G0223800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1241430.0AC124143.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0053D02, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025881188.10.0WUSCHEL-related homeobox 12
SwissprotA3B6V00.0WOX12_ORYSJ; WUSCHEL-related homeobox 12
TrEMBLA0A0D3GAV40.0A0A0D3GAV4_9ORYZ; Uncharacterized protein
TrEMBLI1PXZ00.0I1PXZ0_ORYGL; Uncharacterized protein
STRINGORGLA05G0223800.10.0(Oryza glaberrima)
STRINGOBART05G25900.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26663470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.12e-46homeobox-3
Publications ? help Back to Top
  1. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]