PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA05G0156500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 327aa    MW: 34190.2 Da    PI: 6.3366
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA05G0156500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.51.2e-373892660
             zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                        +cprC+s ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++
  ORGLA05G0156500.1 38 PNCPRCESPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRR 92
                       68***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-302892IPR003851Zinc finger, Dof-type
PfamPF027011.0E-313892IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7233892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MLSSHCESML AYAAAAGRRA VVVDHHQRRY RPNVEVAPNC PRCESPNTKF CYYNNYSLSQ  60
PRYFCKGCRR YWTKGGSLRN VPVGGGCRKN RRGKAVRAMV GETMTARGGG GGGAAAFSHR  120
FHGPVRPDMI LEGMAGSTAA SAGLGEQPGV AAPDEKPTAA DGSTIDLALL YAKFLNHHQP  180
TMAEQGGGAA VPESVDTSSG SSSDRTTSPA AAQPAAAAAY GPGQDGLVGE PISTEEHGAA  240
AMARCAQALG ELNFSVDQIS CYTSLGLPTT DGGDLILPST LDQHAKYEPF DSLPEDALSL  300
HDIISGDDDV WCNALGCQGL EAALCRP
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA05G0156500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1474620.0AC147462.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone B1110B01, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638935.10.0uncharacterized protein LOC4338919
TrEMBLI1PW170.0I1PW17_ORYGL; Uncharacterized protein
STRINGORGLA05G0156500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.16e-36Dof family protein