PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA05G0009500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 352aa    MW: 36486.6 Da    PI: 8.5766
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA05G0009500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.23.2e-37100158361
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        e  lkcprCdstntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  ORGLA05G0009500.1 100 EPGLKCPRCDSTNTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 158
                        56789************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3983157IPR003851Zinc finger, Dof-type
PfamPF027017.3E-32103157IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.789103157IPR003851Zinc finger, Dof-type
PROSITE patternPS013610105141IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MIFPPAFLDS SSWNDNNNNN HNQQQQQQHA HGHHQHHQVA TGCGGGGGGG DGNNSHELLQ  60
QQSMIPGTLA DGGGGGGAVG PAKPMSMSER ARLARIPLPE PGLKCPRCDS TNTKFCYFNN  120
YSLSQPRHFC RACRRYWTRG GALRNVPVGG GYRRHAKRAK PKPASAAGSA SAATTTAGST  180
PAGSTTTTTS STCATPNAPA LPAMLGGNLS ILPPLLRLAD FDAMSLGSTF SGMAAAAGKP  240
PPVDAAGCYS VGAATGLEQW RLQQMQSFPF FHAMDHQAAM AAPPPAMAMP GMFQLGLDGD  300
GHGGGGGEDG GELHHAMPSS KREGYPRGMY GDHHLAGGYT SYSSATTGNH LL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA05G0009500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1089330.0AK108933.1 Oryza sativa Japonica Group cDNA clone:002-153-A09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638255.11e-165dof zinc finger protein DOF3.6 isoform X1
TrEMBLI1PRU70.0I1PRU7_ORYGL; Uncharacterized protein
STRINGORGLA05G0009500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-45OBF-binding protein 3