PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA04G0238000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 236aa    MW: 25783.5 Da    PI: 9.7874
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA04G0238000.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-1991150357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        +R+++++eq+++Le l++   r+p+  ++e+++++l    +++ ++V++WFqN++a+e++
  ORGLA04G0238000.1  91 TRWNPSAEQIKVLEMLYRGgMRTPNSVQIERITEELgkygRIEGKNVFYWFQNHKARERQ 150
                        8*****************99**************************************97 PP

2Wus_type_Homeobox115.91.9e-3790152365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +tRW+P++eQik+Le+ly+ G+rtPn+ +i+rit+eL +yG+ie+kNVfyWFQN+kaRerqkq
  ORGLA04G0238000.1  90 TTRWNPSAEQIKVLEMLYRGGMRTPNSVQIERITEELGKYGRIEGKNVFYWFQNHKARERQKQ 152
                        79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.92886151IPR001356Homeobox domain
SMARTSM003892.3E-688155IPR001356Homeobox domain
SuperFamilySSF466893.21E-1290156IPR009057Homeodomain-like
CDDcd000862.72E-591152No hitNo description
Gene3DG3DSA:1.10.10.601.4E-791150IPR009057Homeodomain-like
PfamPF000464.7E-1791150IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MRLHHLHVAY LDHKASSSSS SPAPPSISPS SIPGSAAFPA FSFKCLRPLA PKISLPEPRK  60
MIAPPDFVVP RARNASKLLN YTVQVPAAGT TRWNPSAEQI KVLEMLYRGG MRTPNSVQIE  120
RITEELGKYG RIEGKNVFYW FQNHKARERQ KQKRAALLTL STLDPSLLPA TANETKEAPE  180
KKEKDVEDGL ASCKRRCKAW GDGAGDGDAV VATEAAGGCT DEVTLELFPL HPQGKA
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA04G0238000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF8361590.0JF836159.1 Oryza sativa Japonica Group WUSCHEL-like homeobox protein (WOX4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635367.11e-176WUSCHEL-related homeobox 4
SwissprotQ25AM21e-177WOX4_ORYSI; WUSCHEL-related homeobox 4
SwissprotQ7XTV31e-177WOX4_ORYSJ; WUSCHEL-related homeobox 4
TrEMBLA0A0D3G0Z21e-174A0A0D3G0Z2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0H6P11e-174A0A0E0H6P1_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PEX61e-174A0A0E0PEX6_ORYRU; Uncharacterized protein
TrEMBLF6MIV61e-174F6MIV6_ORYSJ; WUSCHEL-like homeobox protein
TrEMBLI1PQB11e-174I1PQB1_ORYGL; Uncharacterized protein
STRINGORUFI04G29140.11e-175(Oryza rufipogon)
STRINGONIVA04G25940.11e-175(Oryza nivara)
STRINGORGLA04G0238000.11e-175(Oryza glaberrima)
STRINGOBART04G27560.11e-175(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP126923035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.19e-38WUSCHEL related homeobox 4