PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA04G0206400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 391aa    MW: 41867.7 Da    PI: 7.9448
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA04G0206400.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.28.1e-25119163145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  ORGLA04G0206400.1 119 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVEA 163
                        79****************************************996 PP

2QLQ591.4e-205893237
                QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                       +FTaaQ ++L++Q+l+yKyL+a++PvP++Ll++i++
  ORGLA04G0206400.1 58 PFTAAQYEELEQQALIYKYLVAGVPVPADLLLPIRR 93
                       9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.4E-115793IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.1875893IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.0E-145892IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.517119163IPR014977WRC domain
PfamPF088794.0E-21120162IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MAMPFASLSP AADHRPSSIF PFCRSSPLSA VGEEAQQHMM GARWAAAAAA AAVARPPPFT  60
AAQYEELEQQ ALIYKYLVAG VPVPADLLLP IRRGLDSLAS RFYHHPVLGY GSYFGKKLDP  120
EPGRCRRTDG KKWRCSKEAA PDSKYCERHM HRGRNRSRKP VEAQLVAPHS QPPATAPAAA  180
VTSTAFQNHS LYPAIANGGG ANGGGGGGGG GGSAPGSFAL GSNTQLHMDN AASYSTVAGA  240
GNKDFRYSAY GVRPLADEHS PLITGAMDTS IDNSWRLLPS QTSTFSVSSY PMLGNLSELD  300
QNTICSLPKA EREPLSFFGS DYVTVDSGKQ ENQTLRPFFD EWPKARDSWP DLADDNSLAT  360
FSATQLSISI PMATSDFSTT SSRSHNGIYS R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5466930.0FJ546693.1 Oryza sativa Indica Group cultivar IR58 growth-regulating factor 3 (GRF3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634332.10.0PREDICTED: growth-regulating factor 3 isoform X1
RefseqXP_015634333.10.0PREDICTED: growth-regulating factor 3 isoform X2
SwissprotQ6AWY60.0GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLI1PPE50.0I1PPE5_ORYGL; Uncharacterized protein
STRINGORGLA04G0206400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-45growth-regulating factor 5