PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA04G0190600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 378aa    MW: 37585.6 Da    PI: 8.6719
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA04G0190600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-3974135263
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                        kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  ORGLA04G0190600.1  74 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 135
                        7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3170132IPR003851Zinc finger, Dof-type
PfamPF027012.5E-3376132IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05978132IPR003851Zinc finger, Dof-type
PROSITE patternPS01361080116IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MDAAHWHQGL GLVKPMEEML MAANAAAGAN PNPAATAPSS VTGGALRGGG GGGAPPVAGG  60
AGAGSTERRA RPQKEKALNC PRCNSTNTKF CYYNNYSLQQ PRYFCKTCRR YWTEGGSLRN  120
VPVGGGSRKN KRSSSSAASA SPASASTANS VVTSASMSMS MASTGGGASK NPKLVHEGAQ  180
DLNLAFPHHG GLQAPGEFPA FPSLESSSVC NPGGPMGTNG RGGGALSAME LLRSTGCYMP  240
LQVPMQMPAE YATPGFALGE FRAPPPPPQS SQSLLGFSLD AHGSVGGPSA AGFGSSAGLQ  300
GVPESTGRLL FPFEDLKPTV SSGTGGGGAS GGGGGVDGGH QFDHGKEQQA GGGGGGPGGH  360
DTPGFWNGMI GGGSGTSW
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA04G0190600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281290.0AB028129.1 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637008.10.0dof zinc finger protein 1 isoform X1
SwissprotQ9SXG80.0DOF1_ORYSJ; Dof zinc finger protein 1
TrEMBLI1PNY70.0I1PNY7_ORYGL; Uncharacterized protein
STRINGORGLA04G0190600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.13e-43Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]