PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0367800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 969aa    MW: 105658 Da    PI: 5.2234
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0367800.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1308.5e-41151228178
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        +CqvegC+adl+ +++yhrrhkvCe+h+ka++++v ++ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  ORGLA03G0367800.1 151 ACQVEGCTADLTGVRDYHRRHKVCEMHAKATTAVVGNTVQRFCQQCSRFHPLQEFDEGKRSCRRRLAGHNRRRRKTRP 228
                        5**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.4E-34145213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-38150230IPR004333Transcription factor, SBP-box
PfamPF031101.6E-30152225IPR004333Transcription factor, SBP-box
SuperFamilySSF484034.04E-8750856IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.4E-7754859IPR020683Ankyrin repeat-containing domain
CDDcd002041.89E-8756856No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 969 aa     Download sequence    Send to blast
MEAARVGAQS RHLYGGGLGE PDMDRRDKRL FGWDLNDWRW DSDRFVATPV PAAEASGLAL  60
NSSPSSSEEA GAASVRNVNA RGDSDKRKRV VVIDDDDVED DELVENGGGS LSLRIGVDAV  120
AHGAGVGGGA DEEDRNGKKI RVQGGSPSGP ACQVEGCTAD LTGVRDYHRR HKVCEMHAKA  180
TTAVVGNTVQ RFCQQCSRFH PLQEFDEGKR SCRRRLAGHN RRRRKTRPEV AVGGSAFTED  240
KVSSYLLLGL LGVCANLNAD NAEHLRGQEL ISGLLRNLGA VAKSLDPKEL CKLLEACQSM  300
QDGSNAGTSE TANALVNTAV AEAAGPSNSK MPFVNGDQCG LASSSVVPVQ SKSPTVATPD  360
PPACKFKDFD LNDTYGGMEG FEDGYEGSPT PAFKTTDSPN CPSWMHQDST QSPPQTSGNS  420
DSTSAQSLSS SNGDAQCRTD KIVFKLFEKV PSDLPPVLRS QILGWLSSSP TDIESYIRPG  480
CIILTVYLRL VESAWKELSD NMSSYLDKLL NSSTGNFWAS GLVFVMVRHQ IAFMHNGQLM  540
LDRPLANSAH HYCKILCVRP IAAPFSTKVN FRVEGLNLVS DSSRLICSFE GSCIFQEDTD  600
NIVDDVEHDD IEYLNFCCPL PSSRGRGFVE VEDGGFSNGF FPFIIAEQDI CSEVCELESI  660
FESSSHEQAD DDNARNQALE FLNELGWLLH RANIISKQDK VPLASFNIWR FRNLGIFAME  720
REWCAVTKLL LDFLFIGLVD IGSQSPEEVV LSENLLHAAV RMKSAQMVRF LLGYKPNESL  780
KGTAETFLFR PDAQGPSKFT PLHIAAATDD AEDVLDALTN DPGLVGINTW RNARDDAGFT  840
PEDYARQRGN DAYLNMVEKK INKHLGKGHV VLGVPSSIHP VISDGVKPGE VSLEIGMTVP  900
PPAPRCNACS RQALMYPNST ARTFLYRPAM LTVMGIAVIC VCVGLLLHTC PKVYAAPTFR  960
WELLERGPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-31145225484squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0698470.0AK069847.1 Oryza sativa Japonica Group cDNA clone:J023034C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631511.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
SwissprotQ75LH60.0SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLA0A0D3FR040.0A0A0D3FR04_9ORYZ; Uncharacterized protein
TrEMBLI1PH320.0I1PH32_ORYGL; Uncharacterized protein
STRINGORGLA03G0367800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12