PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0322700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 359aa    MW: 36697.5 Da    PI: 9.6458
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0322700.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.5e-3876133360
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        ++ l+cprC+s+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk + 
  ORGLA03G0322700.1  76 QAPLRCPRCNSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKPRP 133
                        66789**************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.8E-3278132IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-2679128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.09679133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MIQELLGGTT MDQLKGASAL NHASLPVVLQ PIVSNPSPTS SSSTSSRSSA QATQQRSSSA  60
TSSPHGQGQG GGAAEQAPLR CPRCNSSNTK FCYYNNYNLT QPRHFCKTCR RYWTKGGALR  120
NVPIGGGCRK PRPMPAPVAK PPMSCKAAPP LGLGGGPVSW ASGQQAATAH LMALLNSARG  180
VQGHGGSNVH RLLGLDTMGH LQILPGAPNG AGAGTAASLW PQSAPRPVTP PPPHMDSQLG  240
MGTLGHHDVL SSLGLKLPSS ASSSPAASYY SDQLHAVVSN AGRPQAPYDV ATASLPCTTA  300
VTSLPSALSS VSAAAPTSNT VGMDLPPVSL AAPEMQYWNG PAAMSVPWPD LPTPNGAFP
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA03G0322700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0990430.0AC099043.6 Oryza sativa chromosome 3 BAC OSJNBa0079B15 genomic sequence, complete sequence.
GenBankAK0633800.0AK063380.1 Oryza sativa Japonica Group cDNA clone:001-114-F11, full insert sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629418.10.0dof zinc finger protein 4-like
TrEMBLI1PFT10.0I1PFT1_ORYGL; Uncharacterized protein
TrEMBLQ10EQ10.0Q10EQ1_ORYSJ; Dof domain, zinc finger family protein, expressed
STRINGOS03T0764900-010.0(Oryza sativa)
STRINGORGLA03G0322700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.12e-30Dof family protein