PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0291000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GeBP
Protein Properties Length: 375aa    MW: 40012.8 Da    PI: 7.0732
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0291000.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57387.12.3e-2787181297
             DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelsk 93 
                        +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+ + +++sql+eK+rrLK+Kf+++++++++g +p+  ++hd+++++l++
  ORGLA03G0291000.1  87 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPSPYTRSQLSEKLRRLKNKFRGMSARVARGLDPARLAPHDRDVLHLCS 177
                        79*******************.556878888************************************************************* PP

             DUF573  94 kiWg 97 
                        ++W+
  ORGLA03G0291000.1 178 RLWD 181
                        ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-2488181IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MASDQTLPVP VSVELPPAAP NPPDPTAPLL PHADDPSAPA AAAAAAARKL PVKRRSPPPR  60
PSSPSSSDPA SDPAAKQQPQ QPPPPFKFQR IWSESDELRF LQGLLGCGAQ GLVFPRDLNV  120
FYDRFSESMP SPYTRSQLSE KLRRLKNKFR GMSARVARGL DPARLAPHDR DVLHLCSRLW  180
DPANATTSPF AAAGDASSGN KRRRAAPRAG PLMPPDPSGD SNSHDYNGGI SAGTPGAFGD  240
GHGGEEMMYL EQESGHFGYH GDVAIAADGS LDGIVKVQPE TLPALPSIGD IAVHSENGNG  300
KAVVPRSNEH HMANAVLDIF EECLREVKAN GITYGANVNG GSELARRWRA QRIDELDVLS  360
RRLRLLVEDA AAAGR
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA03G0291000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0871810.0AC087181.9 Oryza sativa Japonica Group cultivar Nipponbare chromosome 3 clone OSJNBa0018H01 map R1538, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCT8338990.0CT833899.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN056B15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628567.10.0probable transcription factor At5g28040
TrEMBLI1PEW40.0I1PEW4_ORYGL; Uncharacterized protein
STRINGORGLA03G0291000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.21e-09DNA-binding storekeeper protein-related transcriptional regulator