PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0271000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 426aa    MW: 47783.9 Da    PI: 9.6613
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0271000.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.36.6e-24151195145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+epgrCrRtDGKkWRCs+++++++k+CErH++r+r+rsrk++e+
  ORGLA03G0271000.1 151 DPEPGRCRRTDGKKWRCSKEAMADHKYCERHINRNRHRSRKPVEN 195
                        79****************************************997 PP

2QLQ57.25e-2092127237
                QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                        +FT++Q+++L++Q+l+yKyL+a++P+P+ Ll  i+k
  ORGLA03G0271000.1  92 PFTPSQWMELEHQALIYKYLNAKAPIPSSLLISISK 127
                        9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-1191127IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.76292127IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.6E-1492125IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.803151195IPR014977WRC domain
PfamPF088793.7E-20152194IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MFADFSAAAM ELGEVLGLQG LTVPSTKEGD LSLIKRAAAG SFTQAAAASY PSPFLDEQKM  60
LRFAKAAHTL PSGLDFGREN EQRFLLSRTK RPFTPSQWME LEHQALIYKY LNAKAPIPSS  120
LLISISKSFR SSANRMSWRP LYQGFPNADS DPEPGRCRRT DGKKWRCSKE AMADHKYCER  180
HINRNRHRSR KPVENQSRKT VKETPCAGSL PSSVGQGSFK KAKVNEMKPG SISYWTDSLN  240
RTMANKEKGN KAAEENNGPL LNLTNQQPTL SLFSQLKQQN KPEKFNTAGD SESISSNTML  300
KPWESSNQQN NKSIPFTKMH DRGCLQSVLQ NFSLPKDEKM EFQKSKDSNV MTVPSTFYSS  360
QEDPRVSCHA PNMAQMQEDS ISSSWEMPQG GPLGEILTNS KNPDDSIMKP EARPYGWLLN  420
LEDHAM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0586590.0AK058659.1 Oryza sativa Japonica Group cDNA clone:001-018-F11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627920.10.0PREDICTED: growth-regulating factor 9
SwissprotQ9FRG80.0GRF9_ORYSJ; Growth-regulating factor 9
TrEMBLI1PEB40.0I1PEB4_ORYGL; Uncharacterized protein
STRINGORGLA03G0271000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131242529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.12e-34growth-regulating factor 1