PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0243400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 536aa    MW: 61152.4 Da    PI: 8.7496
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0243400.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.41.7e-15361171198
                        HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                 B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                         +++ +++p kf++++gg+   s t++l++++g  + v++  +k+++++vl+ GW+ Fv+a++++e+D+++F+++++s+f   v +f+
  ORGLA03G0243400.1  36 DSRRSMIMPCKFVNHFGGD--FSGTIKLQSPNGILYVVEV--TKCKNKTVLRCGWEAFVDAHHIEENDSLLFRRVENSRF--EVLIFD 117
                        45566999*****888999..7779***************..*******************************8888888..888887 PP

2B341.52.3e-132513331798
                        E--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS..SEE..EEEEE- CS
                 B3  17 vlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr..sefelvvkvfr 98 
                        v++  +ae h   +++s+t+tl+   ++++W  ++  rk  ++ +l++ W eFvk+n+++e D++vF  +++  ++f+++v+++r
  ORGLA03G0243400.1 251 VISFCYAEVHF--PHKSVTVTLQRpCKSKKWHPRFYKRKDARMNILRGSWVEFVKDNRVQEQDICVFVPTKDarRNFTFTVHLLR 333
                        33333344443..56899******5677*******77888889*************************66442577888887776 PP

3B347.53.3e-154445211090
                        HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                 B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                        + ++++l l  +fa++  ++ ++  + ++ +++g++W   +++r + +r ++ +GW +Fv++n+L++gD+++F+++ +++ 
  ORGLA03G0243400.1 444 SASRCQLELGARFAAAVHLPDRR--QTVVLQRRGERWATVMQIRSGTRRLLI-SGWHRFVRDNRLRVGDICLFEFKTHERW 521
                        345599********999888655..3666778*********88888877655.5********************8755444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.16E-2322121IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.7E-2024120IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.19626119IPR003340B3 DNA binding domain
CDDcd100172.90E-1928117No hitNo description
SMARTSM010194.9E-1029119IPR003340B3 DNA binding domain
PfamPF023623.9E-1437117IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.4E-19226333IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.24E-18227333IPR015300DNA-binding pseudobarrel domain
CDDcd100171.47E-17234333No hitNo description
SMARTSM010190.0022234335IPR003340B3 DNA binding domain
PROSITE profilePS5086310.701235335IPR003340B3 DNA binding domain
PfamPF023621.5E-11250333IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-20424527IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-18425528IPR015300DNA-binding pseudobarrel domain
CDDcd100172.32E-15430532No hitNo description
PROSITE profilePS5086311.998435529IPR003340B3 DNA binding domain
SMARTSM010194.5E-4436534IPR003340B3 DNA binding domain
PfamPF023627.0E-13445522IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MAGSGSCMKK SCVCCQKYLE HLDGKMNCFV RRMTADSRRS MIMPCKFVNH FGGDFSGTIK  60
LQSPNGILYV VEVTKCKNKT VLRCGWEAFV DAHHIEENDS LLFRRVENSR FEVLIFDSDD  120
CEKVFSCAGI RNTCKSIQEK SSSSCDDTAE SSESEGFARN QKGSFSHRRK TANLASSSED  180
SGEDSPSEHE SVESGDLETS QEPYVLSRRS YLSEFQKDKV DALIQEIQPE TTAFVAIMRK  240
SNVQLPTPFL VISFCYAEVH FPHKSVTVTL QRPCKSKKWH PRFYKRKDAR MNILRGSWVE  300
FVKDNRVQEQ DICVFVPTKD ARRNFTFTVH LLRVAAAYSR GGTGVDRAGS SLGRTDVKSA  360
SEISIKEEPI DQEENVSSRN RNGVSDESEE DEDSEGPAHP PYIVPCKSRL SRLQKKIVEE  420
KVRSIQSKFP VYVAIMKKSN VERSASRCQL ELGARFAAAV HLPDRRQTVV LQRRGERWAT  480
VMQIRSGTRR LLISGWHRFV RDNRLRVGDI CLFEFKTHER WRLTMAVHAI FREQCC
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA03G0243400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1193990.0AK119399.1 Oryza sativa Japonica Group cDNA clone:001-132-D12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633049.10.0B3 domain-containing protein Os03g0619600
RefseqXP_015633050.10.0B3 domain-containing protein Os03g0619600
SwissprotQ6AV220.0Y3196_ORYSJ; B3 domain-containing protein Os03g0619600
TrEMBLI1PDI80.0I1PDI8_ORYGL; Uncharacterized protein
STRINGORGLA03G0243400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.12e-15B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]