PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0243100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 338aa    MW: 34469.1 Da    PI: 8.5091
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0243100.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.22.3e-3548102559
             zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                          +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+ 
  ORGLA03G0243100.1  48 REQCPRCASHDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKRP 102
                        579*************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.55949103IPR003851Zinc finger, Dof-type
PfamPF027017.7E-3149101IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-225096IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
PfamPF139629.0E-7304334IPR026961PGG domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MPGQVMEAAL QQLPASMASG SLLLPPACLQ HPLPAAAAAS GGVGGSSREQ CPRCASHDTK  60
FCYYNNYNTS QPRHFCRACR RYWTLGGSLR NVPIGGSTRK RPRPPVRRPP VHFAAAAAPP  120
HHYHHHHGGP LTPPPATSSS SQQAGLLGSL FALGAAPLLE GRVGVGFDLG LGLPGPGHHH  180
AVAGGGGPAA AVATSSSSSA AAPLLWPTGL LDSSSNNAET WRMAAGGMWP EFTAAAAQNI  240
RLVIDIGDTT IQVPLNGPTV VQNIGRQAAA AAVAGDSSAG GVSEKTGGAG GGGGEEWMQE  300
QDGLLCMRGW LMAVATLFAA MAFQAALRPP GWMPAEAA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199103KRPRP
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA03G0243100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1072060.0AC107206.4 Oryza sativa chromosome 3 BAC OSJNBa0063J18 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025880163.11e-113dof zinc finger protein MNB1A-like
TrEMBLI1PDI50.0I1PDI5_ORYGL; Uncharacterized protein
STRINGORGLA03G0243100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1257544
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-25DOF zinc finger protein 1