PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0151500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 356aa    MW: 36474.8 Da    PI: 8.487
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0151500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.43.3e-1540100257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  ORGLA03G0151500.1  40 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLerfgAVGDANVFYWFQNRRSRSRR 100
                        89*****************99*************************************997 PP

2Wus_type_Homeobox106.61.5e-3439102265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
  ORGLA03G0151500.1  39 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLERFGAVGDANVFYWFQNRRSRSRRRQ 102
                        589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-1436108IPR009057Homeodomain-like
PROSITE profilePS5007111.25636101IPR001356Homeobox domain
SMARTSM003891.2E-638105IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-840107IPR009057Homeodomain-like
PfamPF000466.1E-1340100IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MEGSSNSPDR QSSGGSPPEE RGGGGSGGGG GRSAAGEPVR SRWTPKPEQI LILESIFNSG  60
MVNPPKDETV RIRKLLERFG AVGDANVFYW FQNRRSRSRR RQRQMQAAAA AAAAAASSSS  120
PSANTSPAAA SAATVQVGLP PGAVVHTMAM GGSACQYEQQ ASSSSSSGST GGSSLGLFAH  180
GAGASGAGGY LQASCGASAS ASSALAPGLM GDVVDSGGSD DLFAISRQMG FVGSPRCSPA  240
SSPATPSSAA TAAQQQFYSC QLPAATITVF INGVPMEMPR GPIDLRAMFG QDVMLVHSTG  300
ALLPVNDYGI LMQSLQIGES YFLVTIHLQA LTSWSHRSLS TPISQCSFVF MKAPHF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12031RGGGGSGGGGGR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA03G0151500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1110000.0AK111000.1 Oryza sativa Japonica Group cDNA clone:002-174-E11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629005.10.0WUSCHEL-related homeobox 6 isoform X1
SwissprotQ10M290.0WOX6_ORYSJ; WUSCHEL-related homeobox 6
TrEMBLI1PAW90.0I1PAW9_ORYGL; Uncharacterized protein
TrEMBLQ10M280.0Q10M28_ORYSJ; Homeobox domain containing protein, expressed
STRINGOS03T0325600-010.0(Oryza sativa)
STRINGORGLA03G0151500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.21e-31WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]