PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0119600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 404aa    MW: 40921.2 Da    PI: 9.6676
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0119600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.9e-3987146261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        +e alkcprCdstntkfCyynnyslsqPr+fCk+CrryWt+GG+lrnvPvGgg+r+nk+s
  ORGLA03G0119600.1  87 PEPALKCPRCDSTNTKFCYYNNYSLSQPRHFCKTCRRYWTRGGSLRNVPVGGGCRRNKRS 146
                        67899*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3671145IPR003851Zinc finger, Dof-type
PfamPF027016.6E-3390145IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.75891145IPR003851Zinc finger, Dof-type
PROSITE patternPS01361093129IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MVFPSVPAYL DPPNWNNQQG QPPRPANVGG GDAQHLPVGP TAAAAAPGEI GGLPTSSSSA  60
SAAAAAAQQA RPNSMAERAR LARAPQPEPA LKCPRCDSTN TKFCYYNNYS LSQPRHFCKT  120
CRRYWTRGGS LRNVPVGGGC RRNKRSGKSS SAAAAGASSS SSKPSSSAAR QLPGGGASPM  180
PSAAASTQPG GAAAGAIIPP SGLSSMSHHL PFLGAMHPPG PNLGLTFSAG FQPLGGMHHH  240
VDTADQFPVA SGGGATIGAS LEQWRVQQQQ QQQQPQQHQF PFLGGALELP PPPPMYQLGL  300
EATRAAGTGA TAAAAFTLGQ TSATATTSRQ EGSMKLEDSK GLEMSLQRQY MAALRQGDGV  360
WGNNNGGNGG SDGGGNGGGG SWTMNFPGFH SSSGGGGDDG GGVL
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA03G0119600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2104760.0AC210476.2 Oryza glaberrima clone OG_BBa0060N11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629100.10.0dof zinc finger protein DOF3.6 isoform X1
TrEMBLI1PA000.0I1PA00_ORYGL; Uncharacterized protein
STRINGORGLA03G0119600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123012432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.33e-42OBF-binding protein 3