PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0062800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 310aa    MW: 33463.7 Da    PI: 4.4364
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0062800.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.9e-1972124456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        ++++  eq+++Le+ F  +++++ ++++++A+ lgL+ rqV vWFqNrRa++k
  ORGLA03G0062800.1  72 KRRLALEQVRALERSFDTDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWK 124
                        4467789*********************************************9 PP

2HD-ZIP_I/II127.84.4e-4170162193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl+ eqv++LE+sF++++kL+p+rK+++ar+LglqprqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e++
  ORGLA03G0062800.1  70 EKKRRLALEQVRALERSFDTDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWKTKQLERDFAALRARHDALRADCDALRRDKDALAAEIR 161
                        69**************************************************************************************9998 PP

        HD-ZIP_I/II  93 e 93 
                        e
  ORGLA03G0062800.1 162 E 162
                        6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.38E-1861128IPR009057Homeodomain-like
SMARTSM003894.1E-1969130IPR001356Homeobox domain
PROSITE profilePS5007116.43970126IPR001356Homeobox domain
CDDcd000861.12E-1771127No hitNo description
PfamPF000463.4E-1672124IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.6E-2078125IPR009057Homeodomain-like
PRINTSPR000312.8E-597106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000312.8E-5106122IPR000047Helix-turn-helix motif
PfamPF021832.4E-16126167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MKRPTSSSRK SKKQGEDLAF SEGSLPAVTM EQKDEAEMEE VDDEEEEEVD EDIAGGHAAQ  60
SPSPSCGLGE KKRRLALEQV RALERSFDTD NKLDPDRKAR IARDLGLQPR QVAVWFQNRR  120
ARWKTKQLER DFAALRARHD ALRADCDALR RDKDALAAEI RELREKLPTK PADTAASVKV  180
EAGNDAAAGA AAATVCKDGS SDDSDSSVVF NDEASPYSGA AFIGFGPSFL VDDASAAIVG  240
CSSSLPALES KWHGPYSDDS CKGGVYGFTE EWLAACSGEM AGNDAAGFFS DEHASNLNFG  300
WCASGNEGWE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA03G0062800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8310390.0CT831039.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA023E12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628285.10.0homeobox-leucine zipper protein HOX13 isoform X2
RefseqXP_015628286.10.0homeobox-leucine zipper protein HOX13 isoform X2
SwissprotQ10QP30.0HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLI1P8D20.0I1P8D2_ORYGL; Uncharacterized protein
STRINGORGLA03G0062800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-28homeobox protein 16
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]