PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0049700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 440aa    MW: 47095.8 Da    PI: 7.7933
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0049700.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.3e-39102162262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        ++k+l+cprC s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrk+k++s
  ORGLA03G0049700.1 102 PDKILPCPRCSSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKSKSVS 162
                        7899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3298159IPR003851Zinc finger, Dof-type
PfamPF027013.6E-32104160IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.761106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MGECKVGGGG GGGDCLIKLF GKTIPVPEPG ACAAGDVDKD LQHSGSSTTE PKTQENTVQD  60
STSPPPQPEV VDTEDSSADK NSSENQQQQR DTANQKEKLK KPDKILPCPR CSSMDTKFCY  120
YNNYNINQPR HFCKNCQRYW TAGGAMRNVP VGAGRRKSKS VSAASHFLQR VRAALPGDPP  180
LYAPVKTNGT ILSFGSDLST LDLTEQMKHL KDKFIPTTGI KNTDEMPVGL CAEGLSKTEE  240
SNQTNLKEKV SADRSPNVAQ HPCMSGGAMW PFGVAPPPAY YTSSIAIPFY PAAAAAVAAY  300
WGCMVPGAWN APWPPQSQSQ SVSSSSAASP VSTMTNCFRL GKHPRDGDEE LDSKGNGKVW  360
VPKTVRIDDV DEVARSSIWS LIGIKGDKVG ADDGRGCKLA KVFESKDEAK TSTHTAISSL  420
PFMQGNPAAL TRSVTFQEGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA03G0049700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0609000.0AK060900.1 Oryza sativa Japonica Group cDNA clone:001-035-D05, full insert sequence.
GenBankAK1045230.0AK104523.1 Oryza sativa Japonica Group cDNA clone:006-303-F03, full insert sequence.
GenBankAY2244290.0AY224429.1 Oryza sativa (japonica cultivar-group) isolate 20575 putative H-protein promoter binding factor-2a mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631794.10.0cyclic dof factor 1
TrEMBLA0A0D3FEC90.0A0A0D3FEC9_9ORYZ; Uncharacterized protein
TrEMBLI1P8010.0I1P801_ORYGL; Uncharacterized protein
STRINGORGLA03G0049700.10.0(Oryza glaberrima)
STRINGOBART03G05210.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.27e-65cycling DOF factor 2