PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA02G0264300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 283aa    MW: 29036.4 Da    PI: 8.9306
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA02G0264300.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.4e-3942101362
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +a+kcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s 
  ORGLA02G0264300.1  42 PEAVKCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRSG 101
                        5789****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-333499IPR003851Zinc finger, Dof-type
PfamPF027013.4E-334499IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4414599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MQEFQSIPGL AGRLFGGAAA ADIRRAQAQQ GPASRCGGIP SPEAVKCPRC ESTNTKFCYY  60
NNYNLSQPRH FCKSCRRYWT KGGVLRNVPV GGGCRKTKRS GSSSAASSAP STPTAATDNA  120
KNQRRASASS PRSSSGGSGN TSPTAAAATT PTTPATPSSN TIAVINHATT TTTTTTNPFP  180
TDVPPPAPIF ADQAAALASL FAPPPPPPLP VFSFAGQAKT EDGIASVLLA GQTTAPTAAT  240
VADMTPFTSL DAGIFELGDV PPAAYWNAGS CWTDVPDPTV YLP
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA02G0264300.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by gibberellin. {ECO:0000269|PubMed:11470159}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623188.11e-142dof zinc finger protein 4
SwissprotQ6Z3451e-143DOF4_ORYSJ; Dof zinc finger protein 4
TrEMBLI1P3T70.0I1P3T7_ORYGL; Uncharacterized protein
STRINGORGLA02G0264300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-34OBF binding protein 4
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]