PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA02G0030600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 467aa    MW: 50080.7 Da    PI: 8.0635
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA02G0030600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.26.3e-40180256278
                        -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        CqvegC++dls+ak yhr+h+vCe hsk+ +v+v+gle+rfCqqCsrfh l efD++krsCrrrL++hn+rrrk+q+
  ORGLA02G0030600.1 180 CQVEGCNVDLSSAKPYHRKHRVCEPHSKTLKVIVAGLERRFCQQCSRFHGLAEFDQKKRSCRRRLHDHNARRRKPQP 256
                        **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.0E-33172241IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.718177254IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.05E-38178259IPR004333Transcription factor, SBP-box
PfamPF031104.3E-31180253IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MGSFGMDWNQ KSSVLWDWEN MPPIGNSANE NPKNVMLAES KLAGVGVDIG HESGHSSGGT  60
FSSSSEIGYG SSKSSISASI DSPSKVGNTI ELNFASAEEH DKNMDKGKSK VDDTGTSRSP  120
VVAANRVEPL IGLKLGKRTY FEDVCGGQNV KSSPSGVSVA TPGLAKKVKV AQQNTQNPHC  180
QVEGCNVDLS SAKPYHRKHR VCEPHSKTLK VIVAGLERRF CQQCSRFHGL AEFDQKKRSC  240
RRRLHDHNAR RRKPQPEAIS LSSSRLSTLL YGDARQQASF LFGQAPYGQM GSCASSWDNP  300
VPGGFKFTAT KAPWSRPTIA AGVDGTHVSN QQASGNVLPH GAHHSFDGLM AFKETNAKVL  360
NQGMEASAVA SGSARGPDFE HALSLLSIDS VGAANLQPGS QIHPGVTAIA GTSNPVMMPS  420
PAIWQGGLSL DQQAQFQAFD RLGNDDDEDH LQLPKPSYDN SHYDQMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-271802531184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235252KKRSCRRRLHDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2429840.0AK242984.1 Oryza sativa Japonica Group cDNA, clone: J090094N03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626884.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626883.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626882.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626881.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626880.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626879.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
RefseqXP_015626878.10.0PREDICTED: squamosa promoter-binding-like protein 3 isoform X1
SwissprotA2X0Q60.0SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z80.0SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLA0A0D3F0H70.0A0A0D3F0H7_9ORYZ; Uncharacterized protein
TrEMBLI1NX500.0I1NX50_ORYGL; Uncharacterized protein
STRINGORGLA02G0030600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.35e-42squamosa promoter binding protein-like 2