PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0346000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 192aa    MW: 20129.8 Da    PI: 5.875
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0346000.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP98.51.3e-30122187570
                TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                          r+ ++h kv+gR+RR+R++++caar+ +L++eLG+++d++ti WL+qq++pai ++tgt++ +a
  ORGLA01G0346000.1 122 PPRNRDRHVKVEGRGRRIRMPVNCAARIGQLTRELGHKSDGETIRWLMQQSEPAIVAATGTGTVPA 187
                        5799*********************************************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.8E-25125189IPR005333Transcription factor, TCP
PROSITE profilePS5136924.818125179IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MASQLQGKGA ETAAAGERVA PGTNAAAFAV LGYPPIQSPV ALQEEEGPRD AAFAGYAPIR  60
SPVVSRLQEK GEGEGEEEEV DKREEAGMAA DGSAFAAGMA LVPKPEPVAV EFLRGLAVAK  120
PPPRNRDRHV KVEGRGRRIR MPVNCAARIG QLTRELGHKS DGETIRWLMQ QSEPAIVAAT  180
GTGTVPAIAT TV
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA01G0346000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061750.0AP006175.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0669G04.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612634.11e-130transcription factor PCF2-like
SwissprotA2YXQ18e-47PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH68e-47PCF2_ORYSJ; Transcription factor PCF2
TrEMBLI1NUC01e-133I1NUC0_ORYGL; Uncharacterized protein
TrEMBLI1QQJ61e-130I1QQJ6_ORYGL; Uncharacterized protein
STRINGORGLA01G0346000.11e-134(Oryza glaberrima)
STRINGORGLA09G0132500.11e-131(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.13e-37TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]