PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0337900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 425aa    MW: 47094.4 Da    PI: 8.905
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0337900.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.37.8e-50351602128
                NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                        +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + 
  ORGLA01G0337900.1  35 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIR 125
                        79***************************.89***************888889*************************************** PP

                NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +++++ +glkktLvfy+g+apkg++++W+m+eyrl
  ORGLA01G0337900.1 126 AENNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 160
                        *********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5534180IPR003441NAC domain
PROSITE profilePS5100555.24634181IPR003441NAC domain
PfamPF023651.5E-2436160IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MRQRRWRLRW REEEEEEEGI RRAGEVDGHE DDLVMPGFRF HPTEEELIEF YLRRKVEGKR  60
FNVELITFLD LYRYDPWELP AMAAIGEKEW FFYVPRDRKY RNGDRPNRVT ASGYWKATGA  120
DRMIRAENNR PIGLKKTLVF YSGKAPKGVR SSWIMNEYRL PPADTDRYHK TEISLCRVYK  180
RTGIDDGHGH VSTARSSAHS RGGGAAPVQD NKQGSSSTST PTPPPTPSKL HLLSSECTSP  240
PAIVTDHAAM AAHKAPSPRH HQQQQQQLHA AKPCGGYLQN SSMASAAGGD QQQQFQQDFA  300
AALYQQYSKN TSGAFASTYS LLNLVNAASM GSSAAAIDEL SSLVGHGTPS YINPAAGSHN  360
YSQFLHLPTT PSSHQPTPAP LGTTTAAAAA TLPMSLAAFS DRIWDWNNPI PEAGGRDYST  420
STGFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-533618119165NO APICAL MERISTEM PROTEIN
1ut4_B1e-533618119165NO APICAL MERISTEM PROTEIN
1ut7_A1e-533618119165NO APICAL MERISTEM PROTEIN
1ut7_B1e-533618119165NO APICAL MERISTEM PROTEIN
4dul_A1e-533618119165NAC domain-containing protein 19
4dul_B1e-533618119165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA01G0337900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1029020.0AK102902.1 Oryza sativa Japonica Group cDNA clone:J033113D13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631974.10.0NAC domain-containing protein 35
TrEMBLI1NU390.0I1NU39_ORYGL; Uncharacterized protein
STRINGORGLA01G0337900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-102NAC domain containing protein 35