PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0322200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 320aa    MW: 33749.4 Da    PI: 4.5088
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0322200.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.5e-382380461
             zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                       +a +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  ORGLA01G0322200.1 23 AAPNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 80
                       5679***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-31769IPR003851Zinc finger, Dof-type
PfamPF027016.8E-322479IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8542579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MLPYAPRPPS LLVDRRYKQG AEAAPNCPRC DSPNTKFCYY NNYSLSQPRY FCKGCRRYWT  60
KGGSLRNVPV GGGCRKNRRG KSSSSARSAA DAVSSGRDAA FGHRFPGPVR PDVVLEGMVG  120
NPANPGQAMP DVAAAADGST IDLAMLYAKF LNHPPTDAGL GAVTPESGGH VDEAFDTFSA  180
SSDLSPGILA AASAQFDPNQ DGFGEWSSPA SGNDPTSTAT TATTSMLCTD ASVQAALGEL  240
NFAMDQSCFD SLGLPTDVAG AGSLSSWCSI VPSLSTWEEP KYDSLDSFPD DAMSLHECMI  300
GAPDHDWSVD CQGLEALYMP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA01G0322200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032700.0AP003270.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0505D12.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646108.10.0dof zinc finger protein 4-like
TrEMBLA0A0D3EWN90.0A0A0D3EWN9_9ORYZ; Uncharacterized protein
STRINGOBART01G38400.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.14e-29Dof family protein