PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0305600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 313aa    MW: 33277.5 Da    PI: 10.0595
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0305600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-2043102357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         R+t+tkeq+ +Le l+++  r+p+ae++++++++l    +++ ++V++WFqN++a++++
  ORGLA01G0305600.1  43 ARWTPTKEQIAVLEGLYRQgLRTPTAEQIQQITARLrehgHIEGKNVFYWFQNHKARQRQ 102
                        7*****************99**************************************96 PP

2Wus_type_Homeobox115.52.6e-3742104365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RWtPt+eQi +Le ly++GlrtP++e+iq+ita+L+e+G+ie+kNVfyWFQN+kaR+rqkq
  ORGLA01G0305600.1  42 NARWTPTKEQIAVLEGLYRQGLRTPTAEQIQQITARLREHGHIEGKNVFYWFQNHKARQRQKQ 104
                        78***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.72238103IPR001356Homeobox domain
SMARTSM003892.3E-540107IPR001356Homeobox domain
SuperFamilySSF466892.91E-1243109IPR009057Homeodomain-like
PfamPF000462.6E-1843102IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.7E-843102IPR009057Homeodomain-like
CDDcd000867.63E-54498No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
METTTTTLGG GGGGRAGGFS DPPSPLSPPL SPASAAAAAL ANARWTPTKE QIAVLEGLYR  60
QGLRTPTAEQ IQQITARLRE HGHIEGKNVF YWFQNHKARQ RQKQKQQSFD YFSKLFRRPP  120
PLPVLHRPIA RPFPLAMAPT AMPPPPPPPA TTTTAACNAG GVMFRTPSFM PVATNNASYY  180
PQQQTPLLYP GMEVCPHDKS TAQPPATTTM YLQAPPSSAH LAVAAGRGAA EAEGHGRRGG  240
GAGGRETLQL FPLQPTFVLP DHKPRRAGSA CAAVSPTTPS ASASFSWESE SSDSPSSEAP  300
PFYDFFGVHS GGR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA01G0305600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032410.0AP003241.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0408C03.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644226.10.0WUSCHEL-related homeobox 5
SwissprotA2WWU70.0WOX5_ORYSI; WUSCHEL-related homeobox 5
SwissprotQ8LR860.0WOX5_ORYSJ; WUSCHEL-related homeobox 5
TrEMBLI1NT660.0I1NT66_ORYGL; Uncharacterized protein
STRINGORGLA01G0305600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75093548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-27WUSCHEL related homeobox 2