PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0211300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 532aa    MW: 54687.4 Da    PI: 7.3957
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0211300.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox521.2e-1667127257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        ++R+++ +eq+++Le+ F++   +p ++e+ ++ ++l    ++ +++V++WFqNr+ + k+
  ORGLA01G0211300.1  67 KPRWNPRPEQIRILEAIFNSgMVNPPRDEIPRIRMQLqeygQVGDANVFYWFQNRKSRSKN 127
                        89*****************99*************************************995 PP

2Wus_type_Homeobox110.21.1e-3566128264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei ri+++L+eyG+++d+NVfyWFQNrk+R+++k
  ORGLA01G0211300.1  66 PKPRWNPRPEQIRILEAIFNSGMVNPPRDEIPRIRMQLQEYGQVGDANVFYWFQNRKSRSKNK 128
                        579**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.89663128IPR001356Homeobox domain
SuperFamilySSF466895.13E-1165129IPR009057Homeodomain-like
SMARTSM003892.2E-665132IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-666130IPR009057Homeodomain-like
CDDcd000862.13E-666128No hitNo description
PfamPF000462.6E-1467126IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MASSNRHWPS MFRSKHATQP WQTQPDMAGS PPSLLSGSSA GSAGGGGYSL KSSPFSSVGE  60
ERVPDPKPRW NPRPEQIRIL EAIFNSGMVN PPRDEIPRIR MQLQEYGQVG DANVFYWFQN  120
RKSRSKNKLR SGGTGRAGLG LGGNRASAPA AAHREAVAPS FTPPPPILPA PQPVQPQQQL  180
VSPVAAPTSS SSSSSDRSSG SSKPARATST QAMSVTTAMD LLSPLAAACH QQMLYQGQPL  240
ESPPAPAPKV HGIVPHDEPV FLQWPQSPCL SAVDLGAAIL GGQYMHLPVP APQPPSSPGA  300
AGMFWGLCND VQAPNNTGHK SCAWSAGLGQ HWCGSADQLG LGKSSAASIA TVSRPEEAHD  360
VDATKHSLLQ YGFGITTPAV HVDVTSSAAG VLPPVPSSPS PPNAAVTVAS VAATASLTDF  420
AASAISAGAV ANNQFQGLAD FGLVAGACSG AGAAAAGAPE AGSSVAAVVC VSVAGAAPPL  480
FYPAAHFNVR HYGDEAELLR YRGGSRTEPV PVDESGVTVE PLQQGAVYIV VM
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA01G0211300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025875666.10.0WUSCHEL-related homeobox 7
SwissprotQ0JKK60.0WOX7_ORYSJ; WUSCHEL-related homeobox 7
TrEMBLI1NQH30.0I1NQH3_ORYGL; Uncharacterized protein
STRINGORGLA01G0211300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26663470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.16e-44homeobox-3