PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0096800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 490aa    MW: 52888.4 Da    PI: 7.0336
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0096800.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.6e-38110169261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++k+l+cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GGa+rnvPvG+grr+nk++
  ORGLA01G0096800.1 110 PDKILPCPRCNSMETKFCYFNNYNVHQPRHFCRNCQRYWTAGGAMRNVPVGAGRRRNKHV 169
                        7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31107167IPR003851Zinc finger, Dof-type
PfamPF027012.4E-31112168IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.602114168IPR003851Zinc finger, Dof-type
PROSITE patternPS013610116152IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MAALRQGDNP AIKLFGRTIP LLLDPAAAAA ADEDEVMPNL GNGVKTNNDL PLVSDKLLIV  60
KGIPFCPNNS KKNDLQGISR PDGRIEIDSM TEDVKTEPDG SVPEKILKKP DKILPCPRCN  120
SMETKFCYFN NYNVHQPRHF CRNCQRYWTA GGAMRNVPVG AGRRRNKHVL KYRQAMMTCN  180
NTVAPGDVSD VVHHQVITHG SSLLPATLKE NETPTEFISE VPPCKSSASI LDIGEPNDTD  240
LVPLASGDNK EEKSCASSVV VSSCSENLMP DNAIMKEPNN RSGCCNGVAL PFPTGPALVL  300
PWSLGWNSVA LMPATQCSTQ PVLGLKDGIP CPPSWPPQLM VPAPGICTPV VPIPLVPPLW  360
SCFPGWPNGM WNAQCPGGNT TVLPSTAPNK ISCSGSSSLV LGKHSREESL QEEEKTRNYL  420
WVPKTLRIDD PAEAAKSSIW ATLGIKPDDK GIFKSFQPNV AKNGTAPESP QALQANPAAF  480
SRSQSFQETT
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA01G0096800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0669840.0AK066984.1 Oryza sativa Japonica Group cDNA clone:J013091E10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635234.10.0cyclic dof factor 2
TrEMBLI1NM780.0I1NM78_ORYGL; Uncharacterized protein
STRINGORGLA01G0096800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-62cycling DOF factor 2