PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0092800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 550aa    MW: 59752.4 Da    PI: 4.6468
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0092800.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.39.7e-40163222261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  ORGLA01G0092800.1 163 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKSKSS 222
                        7899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-31149220IPR003851Zinc finger, Dof-type
PfamPF027013.2E-32165221IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.863167221IPR003851Zinc finger, Dof-type
PROSITE patternPS013610169205IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MCDKDPGIKL FGRVIPLAPE AEAAAAADGS DQPEAAAAAA EVEPAAQDED HHKETEESKD  60
DEMKVDVPQE EEDNEMKVDA PQEKKDNEVT ADVPEEKGND EMRVDASESI ESIEPVSRST  120
LDNKKEDQGQ MNSVEEKAAS DSKDENEKTA NDESGQDKVL KKPDKILPCP RCNSMDTKFC  180
YYNNYNVNQP RHFCKNCQRY WTAGGTMRNV PVGAGRRKSK SSSLHYRHLL MAPDCMMGSR  240
VEISKSMNPE AFASAHSTPI QPIGRNETVL KFGPEVPLCE SMASVLNIQE QNGTNAAAVP  300
TGENQEDNSC ISSITSHNVL PENAAQVDKN STPVYCNGVG PVPQYYLGAP YMYPWNIGWN  360
NVPMMVPGTS MPESASQSES CSTSSAPWMN MNSPMMPVAS RLSAPPFPYP LVPPALWGCL  420
SSWPATAWNI PWIRTNGGCM SPSSSSNSSC SGNGSPLGKH SRDSSLPLKE DKEEKSLWVP  480
KTLRIDDPDE AAKSSIWATL GIKPGDPGIF KPFQSKGESK GQAASETRPA RALKANPAAL  540
SRSQSFQETS
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA01G0092800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0013830.0AP001383.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, clone:P0453A06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618265.10.0cyclic dof factor 2
TrEMBLI1NM380.0I1NM38_ORYGL; Uncharacterized protein
STRINGORGLA01G0092800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-70cycling DOF factor 2