PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0056600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 215aa    MW: 22877.9 Da    PI: 9.0838
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0056600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.3e-382781458
             zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58
                       + l+cprC+stntkfCyynny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r++
  ORGLA01G0056600.1 27 EGLACPRCESTNTKFCYYNNYNLAQPRHFCKACRRYWTRGGALRNVPVGGGTRNK 81
                       6789*************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.0E-322981IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4162983IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-233179IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MEVAEGRTVA AAAGGGGLGG GARTEAEGLA CPRCESTNTK FCYYNNYNLA QPRHFCKACR  60
RYWTRGGALR NVPVGGGTRN KVAPAPCTGR RXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  120
VAYELPFLPP PPPLPLAAVD PDRRLLDLGG SFTSLLAPAQ LHNGHFTTGF LLGTMSSAPP  180
PPPPPPATST PSPAPAAHPP VSDSIWAMGW PHLSI
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA01G0056600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126091e-152CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645936.13e-81dof zinc finger protein DOF3.1
TrEMBLI1NL261e-124I1NL26_ORYGL; Uncharacterized protein
STRINGORGLA01G0056600.11e-125(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-29DOF zinc finger protein 1