PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB12G23410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 557aa    MW: 62361.4 Da    PI: 8.3662
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB12G23410.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS353.92.4e-1081775481373
          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                   l++lL++cA+av+++d + a++lL++++++a p+gd++qRla++f+e+L+arla+++s + ++l +++ts    ++ l+a++l+  +  + k+s++ 
  OB12G23410.1 177 LRTLLIHCAQAVATDDRRSATELLKQIKQHAKPTGDATQRLAHCFAEGLQARLAGTGSLVHQSLMAKRTS---AVDILQAYQLYMAAICFKKVSFMF 270
                   6789***************************************************999999999998888...9*********************** PP

          GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                    N++I +a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++ iTg++ p++g   +e++eetg+rL+k+A+e++vpf++n+++a+++e+++ e
  OB12G23410.1 271 SNHTIFNASLGKKKIHIVDYGIQYGFQWPCFLRRISQREGGPPEVTITGIDLPQPGfrPTERIEETGRRLSKYAQEFHVPFKYNAIAATKMESVRKE 367
                   *******************************************************9******************************99********* PP

          GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                   +L++ p+E+l+Vn+++q  +l+desv ++s+rd vL+ +k+++P+v++++  + + +++ F++rf eal yysalfd l+a+ prese+r  +E+ +
  OB12G23410.1 368 DLNIAPDEVLIVNCQYQFRTLMDESVVIDSPRDIVLSNIKKMQPHVFIHAIVNGSFSAPFFVTRFREALFYYSALFDILDATTPRESEQRLLIEQTI 464
                   ************************************************************************************************* PP

          GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                   +gr++ nv+aceg++r+er et+++W+ r ++aGFk++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r L+++  W
  OB12G23410.1 465 FGRAALNVIACEGTDRVERPETYKQWQVRNQRAGFKQLPLNPNIVQIVRDKVKDCYHKDFVIDIDHQWLLQGWKGRILYAIATW 548
                   ********************************************************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.698151529IPR005202Transcription factor GRAS
PfamPF035148.3E-106177548IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MSSAFLKGME EANKFLPTEN KLVIDLEASS ENYLRGVEEA KRFLPSDDKL QVGFNARSVA  60
PGTAAAAPVV SVKKESVDVV VGSIGGGGGR KNPYDDEELE LEGGRSSKQT AVQGDDIAAR  120
AMFDQVMMPS HENCTEMMEK LRIAMQEEAA KNEAVSGKGA NGKVKGGRRG GKDIVDLRTL  180
LIHCAQAVAT DDRRSATELL KQIKQHAKPT GDATQRLAHC FAEGLQARLA GTGSLVHQSL  240
MAKRTSAVDI LQAYQLYMAA ICFKKVSFMF SNHTIFNASL GKKKIHIVDY GIQYGFQWPC  300
FLRRISQREG GPPEVTITGI DLPQPGFRPT ERIEETGRRL SKYAQEFHVP FKYNAIAATK  360
MESVRKEDLN IAPDEVLIVN CQYQFRTLMD ESVVIDSPRD IVLSNIKKMQ PHVFIHAIVN  420
GSFSAPFFVT RFREALFYYS ALFDILDATT PRESEQRLLI EQTIFGRAAL NVIACEGTDR  480
VERPETYKQW QVRNQRAGFK QLPLNPNIVQ IVRDKVKDCY HKDFVIDIDH QWLLQGWKGR  540
ILYAIATWAP NDALSYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-441815488374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126200.0CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL8448780.0AL844878.4 Oryza sativa chromosome 12, . BAC OSJNBb0036A19 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL7724250.0AL772425.7 Oryza sativa chromosome 12, . BAC OJ1396_C02 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAK1219430.0AK121943.1 Oryza sativa Japonica Group cDNA clone:J033107F03, full insert sequence.
GenBankAK1115220.0AK111522.1 Oryza sativa Japonica Group cDNA clone:J013002M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664663.20.0PREDICTED: scarecrow-like protein 9, partial
TrEMBLJ3NED30.0J3NED3_ORYBR; Uncharacterized protein
STRINGOB12G23410.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-160GRAS family protein