PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB12G20900.1
Common NameLOC102710937
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 368aa    MW: 40395.2 Da    PI: 7.9612
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB12G20900.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.78.9e-3298154259
                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   dDgynWrKYGqK+vkgs++prsYY+Ct+++Cpvkkkve+++ d+++ ei+Y+g+Hnh+
  OB12G20900.1  98 DDGYNWRKYGQKVVKGSDCPRSYYKCTHPSCPVKKKVEHAE-DGQISEIIYKGKHNHQ 154
                   8**************************************99.***************8 PP

2WRKY107.75.6e-34254312159
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   ldDgy+WrKYGqK+vkg+++prsYY+Ct+agC+v+k++er+++dpk+v++tYeg+Hnhe
  OB12G20900.1 254 LDDGYRWRKYGQKVVKGNPHPRSYYKCTYAGCNVRKHIERASSDPKAVITTYEGKHNHE 312
                   59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-2894156IPR003657WRKY domain
SuperFamilySSF1182903.14E-2596156IPR003657WRKY domain
SMARTSM007741.1E-3397155IPR003657WRKY domain
PROSITE profilePS5081123.19298156IPR003657WRKY domain
PfamPF031061.8E-2498154IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.1E-37240314IPR003657WRKY domain
SuperFamilySSF1182901.44E-29246314IPR003657WRKY domain
PROSITE profilePS5081137.413249314IPR003657WRKY domain
SMARTSM007741.1E-39254313IPR003657WRKY domain
PfamPF031062.4E-26255312IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MLFSPAMGGF GMSHREALAQ VTAQATHSQL RMFNHTEQPS FSAAPTSSEA MQHMNSAVNM  60
AGVSDMVTGA ANNENAAFQS AEASQRYQVN APVDKPADDG YNWRKYGQKV VKGSDCPRSY  120
YKCTHPSCPV KKKVEHAEDG QISEIIYKGK HNHQRPPNKR AKDGSSSAAD QNEQSNDTTS  180
GLSGIKRDQD AMYGMSEQLS SLSDGDDMDD GESRPHEADD KDSDSKKRNI QISSQRTSGE  240
AKIIVQTTSE VDLLDDGYRW RKYGQKVVKG NPHPRSYYKC TYAGCNVRKH IERASSDPKA  300
VITTYEGKHN HEPPVGRGNN QNAGNAAPSS SSQQNMQNLS SNQASLARGN FNNINQRPIG  360
VLQFKSEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-4098314877Probable WRKY transcription factor 4
2lex_A7e-4098314877Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB12G20900.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL7317590.0AL731759.2 Oryza sativa chromosome 12, . BAC OSJNBa0009K11 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664581.20.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ701e-109WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLJ3NDN20.0J3NDN2_ORYBR; Uncharacterized protein
STRINGOB12G20900.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-103WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]