PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB12G20020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 752aa    MW: 83270.8 Da    PI: 6.7686
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB12G20020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.18e-2460161199
                   EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
            B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                   f+k+lt sd++++g +++ +++a+e+       +  ++ +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   + +++
  OB12G20020.1  60 FCKTLTASDTSTHGGFSVLRRHADEClppldmsQ--HPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL--RGDNG 152
                   99*****************************544..455569************************************************..34899 PP

                   ..EEEEE-S CS
            B3  91 elvvkvfrk 99 
                   el+v+v+r+
  OB12G20020.1 153 ELRVGVRRA 161
                   99****996 PP

2Auxin_resp112.15.5e-37186268183
    Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                   a+ha++t+++F+v+Y+Pr+s+seFvv+++ +e++lk++ s+GmRfkm fe+e+++e+r++Gt+vg+ d+dp+ W +SkWrsLk
  OB12G20020.1 186 AWHAVNTGTMFTVYYKPRTSPSEFVVPRDLYEESLKRNHSIGMRFKMTFEGEEAAEQRFTGTIVGIGDSDPSGWADSKWRSLK 268
                   89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.0E-4251175IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-4155189IPR015300DNA-binding pseudobarrel domain
CDDcd100175.86E-2258160No hitNo description
PfamPF023629.8E-2260161IPR003340B3 DNA binding domain
SMARTSM010191.4E-2360162IPR003340B3 DNA binding domain
PROSITE profilePS5086311.87160162IPR003340B3 DNA binding domain
PfamPF065073.6E-34186268IPR010525Auxin response factor
PROSITE profilePS5174523.746624708IPR000270PB1 domain
SuperFamilySSF542772.16E-11627700No hitNo description
PfamPF023095.0E-7671709IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MNVELKAEPD TDEVYAQLTL LPEKQQDGNG NGNGNASKDQ VDEEAAAPPA AAERPRVHSF  60
CKTLTASDTS THGGFSVLRR HADECLPPLD MSQHPPTQEL VAKDLHGVEW RFRHIFRGQP  120
RRHLLQSGWS VFVSAKRLVA GDAFIFLRGD NGELRVGVRR AMRQQANIPS SVISSHSMHL  180
GVLATAWHAV NTGTMFTVYY KPRTSPSEFV VPRDLYEESL KRNHSIGMRF KMTFEGEEAA  240
EQRFTGTIVG IGDSDPSGWA DSKWRSLKVR WDDAASIPRP DRVSPWQIEP ANSPSPPNPP  300
QATRTKRARP NVISSSSDLS AVNKEVASKV IANSQQNGLT RAFHSQESTN LRSRFGDSSE  360
LNTSQKLTMW SSGSNQEKNN AIVQRELGSQ SWMQMRRPDS SSEILSGFQP QKDTRNPLSS  420
FPSQISGNRS NTWNTINVHY PDQNVNHNMF PGTWSFMPPN TAFGVNQQSY LMPPDIPLPQ  480
RSLNAKFSGN GAFTSLRAHG IDQRSSGWPG HIEPSSHIDD ASLSLIKPQP LVIDHNVQKA  540
KGSSCMLFGI SLDSPAKPEQ LISPPSVAFD GKLQQDALEE DECSDPSKTL KPLDGAQHDS  600
ATEKHQSCPE GARNIQTKHN GSSRSCKKVH KQGIALGRSI DLTKFTCYDE LITELDQMFD  660
FNGELSSSCK NWMVVYTDNE GDMMLVGDDP WNEFCNMVHK IFIYTREEVQ KMNPGALNSR  720
SEDSRSTSME RGLVGEGLQG GLSTPSLNSE NC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-137129578359Auxin response factor 1
4ldw_A1e-137129578359Auxin response factor 1
4ldw_B1e-137129578359Auxin response factor 1
4ldx_A1e-137129578359Auxin response factor 1
4ldx_B1e-137129578359Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB12G20020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0652540.0AK065254.1 Oryza sativa Japonica Group cDNA clone:J013002J11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015698650.10.0PREDICTED: auxin response factor 24 isoform X1
SwissprotQ2QQX60.0ARFX_ORYSJ; Auxin response factor 24
TrEMBLJ3NDE40.0J3NDE4_ORYBR; Auxin response factor
STRINGOB12G20020.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117836111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Li G, et al.
    Rice actin-binding protein RMD is a key link in the auxin-actin regulatory loop that controls cell growth.
    Proc. Natl. Acad. Sci. U.S.A., 2014. 111(28): p. 10377-82
    [PMID:24982173]