PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB12G16200.1
Common NameLOC102713973
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 333aa    MW: 36094.9 Da    PI: 8.3609
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB12G16200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK72.84.4e-23249299252
        RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   +k++ l d++ yF+ pi++AA++L+vc+T+LK iCR++G++RWP+Rk++s+
  OB12G16200.1 249 TKKLCLGDVAPYFDQPIAKAARKLDVCATALKAICRKNGVQRWPYRKVRSI 299
                   7899999*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.688239319IPR003035RWP-RK domain
PfamPF020421.1E-19252299IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MLDNFHTDVV DDAPPPPPPP PTLVRSPDHC VASTSSAAPA PPEVTVDCRA CQVLREVVHS  60
NGLETTKLCI HGGDGAFYHA ILDVYRVKSR GLALAHHSII DFRGWGYDWV KQYLTDYAQR  120
RATGGFAVVQ DSLSAFHDAL CTPMPCSSHV SDAYKRAASS VAAARTNGDG DHRLVVQTDA  180
VVQPVASSSG CRVGAEAAAS SGDRQLVIDT AAIQQPASGP SQADHTVHQM QQCFHRADRT  240
ALAIQRERTK KLCLGDVAPY FDQPIAKAAR KLDVCATALK AICRKNGVQR WPYRKVRSID  300
RQIATLRRSG NGDTNEIEML IASRRRIVAG IIE
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB12G16200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL8318062e-47AL831806.5 Oryza sativa chromosome 12, . BAC OSJNBb0106P21 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL9541602e-47AL954160.5 Oryza sativa chromosome 12, . BAC OSJNBb0078J08 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149682e-47AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664445.10.0PREDICTED: uncharacterized protein LOC102713973
TrEMBLJ3NCB20.0J3NCB2_ORYBR; Uncharacterized protein
STRINGOB12G16200.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80552944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-13RWP-RK domain-containing protein