PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB12G15640.1
Common NameLOC102706895
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 202aa    MW: 23182.9 Da    PI: 9.824
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB12G15640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.69.2e-251158350
                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                  ien   rqvtf+kRr g+lKKA ELSvLC+a+v viifss+gkl+e +
  OB12G15640.1 11 IENPVHRQVTFCKRRGGLLKKARELSVLCGADVGVIIFSSQGKLHELA 58
                  9********************************************965 PP

2K-box37.11.3e-138617313100
         K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                     +  +q +  L++ei  Lqr +R     + ++++l  Lq Le+ Le  + + R++K++++ ++i+ l++ke  l+ +n++L++k++e
  OB12G15640.1  86 RKQVAEQGIFLLREEIGLLQRDLRSTYDGGAGEMTLDKLQALEKGLELWMYQTRTTKMQMMQQEIQFLKHKEGILKAANETLQEKVKE 173
                   45667788889**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.16E-27174IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.118161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.23E-35371No hitNo description
PRINTSPR004041.5E-24323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-231156IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.18687177IPR002487Transcription factor, K-box
PfamPF014865.6E-1488171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MVRGKVQMRL IENPVHRQVT FCKRRGGLLK KARELSVLCG ADVGVIIFSS QGKLHELATN  60
GTMHNLVERY QRNVAGGQME RDTLQRKQVA EQGIFLLREE IGLLQRDLRS TYDGGAGEMT  120
LDKLQALEKG LELWMYQTRT TKMQMMQQEI QFLKHKEGIL KAANETLQEK VKEQHKLYIS  180
LLDLHSQQST QSVTYGNCFF SI
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB12G15640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1777000.0AY177700.1 Oryza sativa (japonica cultivar-group) transcription factor MADS33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663909.11e-147PREDICTED: MADS-box transcription factor 33
SwissprotQ2QW551e-126MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLJ3NC561e-146J3NC56_ORYBR; Uncharacterized protein
STRINGOB12G15640.11e-146(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-47AGAMOUS-like 12