PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB12G13360.1
Common NameLOC102708389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 193aa    MW: 21080.7 Da    PI: 8.0837
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB12G13360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.21.1e-10116178163
                   XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                   eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke e+  +e+ +lk  +
  OB12G13360.1 116 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSTQNESMKKERETVMQEYLSLKETN 178
                   89**********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.6E-6113181No hitNo description
PfamPF001703.8E-10116179IPR004827Basic-leucine zipper domain
SMARTSM003381.9E-12116180IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.14118181IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.81E-7120176No hitNo description
CDDcd147022.29E-11121171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MSDHGGDGDM QRQCRRGVAV DVVELGAALA LADMAGAAVK PPPRPACAAQ DDEDEEMVAT  60
TRLTLQLGNN NNSNVGIQSS SCSSSGSSAG RPALPPPPSS STSYGPKLRH MLTEEEKEAK  120
RLRRVLANRE SARQTILRRQ AIRDELARKV ADLSTQNESM KKERETVMQE YLSLKETNKQ  180
LKEQAHHLSL SLF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663833.11e-140PREDICTED: G-box-binding factor 1-like
TrEMBLJ3NBH81e-140J3NBH8_ORYBR; Uncharacterized protein
STRINGOB12G13360.11e-140(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.11e-15bZIP family protein