PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB12G12480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 198aa    MW: 21730.5 Da    PI: 7.9662
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB12G12480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.35e-1175122350
                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                   ++k++ +   NReA r++Rq+Kka +++Lee+vk+L a N++L k+l+
  OB12G12480.1  75 RRKKASKPLGNREAVRKYRQKKKAHTAQLEEEVKKLRAINQQLVKRLQ 122
                   5688888888**********************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-871140IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-1471141No hitNo description
PROSITE profilePS502178.64675122IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-877134No hitNo description
PfamPF077169.0E-1282130IPR004827Basic-leucine zipper domain
CDDcd146863.94E-1185131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MDDGEIELSS QMMFPNPETP TSLDDFMPSI RTTCTHTHTC NAPGPSATAH THTCYHTHTQ  60
VLSTDDDSCG DDKTRRKKAS KPLGNREAVR KYRQKKKAHT AQLEEEVKKL RAINQQLVKR  120
LQGQDALEAE VVRLRSLLVD VRAKINGALG SYPFQAQCGV GNVSSCDGMA QCFVGKSELG  180
VSQSCEPRLM NCHVSPGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3780330.0FQ378033.1 Oryza brachyantha chromosome 12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619735.11e-99PREDICTED: uncharacterized protein LOC107279776
SwissprotQ8VY765e-53BZP19_ARATH; Basic leucine zipper 19
TrEMBLJ3NB901e-148J3NB90_ORYBR; Uncharacterized protein
STRINGOB12G12480.11e-148(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2094757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-35bZIP family protein