PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB12G10480.1
Common NameLOC102722917
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 157aa    MW: 17678.3 Da    PI: 7.885
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB12G10480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.41.2e-4371061100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +Ca+Ck+lrr+C+++Cv+apyfpae++++fa+vh++FGasnv+k+l+++p+ +r da+sslvyeA+ar+rdPvyG+v+ i+ lq+q+++l+++lal+
  OB12G10480.1   7 PCASCKLLRRRCTSECVFAPYFPAEEAQRFAMVHRVFGASNVSKMLQEVPPAQRADAVSSLVYEANARMRDPVYGCVAAISFLQHQVSHLQKQLALA 103
                   7**********************************************************************************************99 PP

        DUF260  98 kee 100
                   +++
  OB12G10480.1 104 HAH 106
                   875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6436107IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-447104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MAGSGTPCAS CKLLRRRCTS ECVFAPYFPA EEAQRFAMVH RVFGASNVSK MLQEVPPAQR  60
ADAVSSLVYE ANARMRDPVY GCVAAISFLQ HQVSHLQKQL ALAHAHTAAL QLQLQQQQQL  120
QHQLQQDHDQ HEHCILQNAL PQLMLQDAFL KKESMWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4831047108LOB family transfactor Ramosa2.1
5ly0_B1e-4831047108LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB12G10480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2417611e-148AK241761.1 Oryza sativa Japonica Group cDNA, clone: J065205C18, full insert sequence.
GenBankAP0149671e-148AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAP0149681e-148AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankBX0004941e-148BX000494.2 Oryza sativa chromosome 12, . BAC OSJNBa0052H10 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0004971e-148BX000497.1 Oryza sativa chromosome 11, . BAC OSJNBa0010K05 of library OSJNBa from chromosome 11 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015698583.11e-112PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-55LBD12_ARATH; LOB domain-containing protein 12
TrEMBLJ3NAP01e-111J3NAP0_ORYBR; Uncharacterized protein
STRINGOB12G10480.11e-112(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-49LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]