PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G28120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 562aa    MW: 62816.8 Da    PI: 6.2504
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G28120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS266.68.1e-8220556016373
          GRAS  16 dlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeerv 112
                   ++++a ++L+++++++s +gd+mqR+a++f+++L+arl +s+ +ly+  + ++    + +e l+++kl+  ++ + k++ l a  +I+ av+g++++
  OB11G28120.1 205 SQQCAGQVLKKIRQHSSATGDAMQRVAHCFAKGLEARLDGSGRQLYQ--SRWRM---SLVEYLKVYKLYMSACSFKKVALLFAAMTIMHAVQGKQKL 296
                   6899****************************************995..33333...499************************************* PP

          GRAS 113 HiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlv 207
                   Hi+D++   Gl+Wp L++ L sR++gpp++RiT v+ p++g   ++++e+ g+ L++ A+elgvpf+f++++a ++e++  ++L+++p+E+l+Vn  
  OB11G28120.1 297 HIVDYG-DCGLHWPDLFRRLGSREGGPPEVRITIVDIPQPGfrPAQRIEASGRCLSSCAKELGVPFRFQAVAAAKWETVGADDLHIDPDEVLVVNDL 392
                   *****9.78*******************************9*9***************************9999*********************** PP

          GRAS 208 lqlhrlldesvsles..erdevLklvkslsPkvvvvveq.eadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvace 301
                   l+   l+desv +e   +rd  L+ + +++++vv +    +a+h ++sFl rf  al yysalfd+l+a++pr se r  +E+ +lg+ + n++ace
  OB11G28120.1 393 LSFSVLMDESVFSEGpsPRDVALRNIGRMRADVVFIQGIaNANH-GASFLSRFRGALLYYSALFDMLDATVPRGSELRLALEQNILGPYALNAIACE 488
                   **********99887779**************997765405555.899************************************************* PP

          GRAS 302 gaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                   ga+ +er e++++W++r ++aG++++pl+ ++ + ++  +++++ + + + e+ ++l++gW++r L++ SaW
  OB11G28120.1 489 GADLVERPEKYRQWQARNHRAGMQQLPLRPEMLAAISDEVKRYHHKDFLLCEDGQWLLQGWMGRVLFAHSAW 560
                   ********************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.947164541IPR005202Transcription factor GRAS
PfamPF035142.8E-79205560IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MGNPEDFFWE ALLKENEAPS PPPVFFEAPT PLTNRDGEDP SLLDNQLLSY ISRMLMEDET  60
GSAAAAKLQR VDRGSTEDLL PGTEVVRAFL KGMEEASKFL PRNNGFGSEE TVQGHGMGRR  120
KKNHDRDEQQ QQLEEEVGSS SKLAALTIAA AEATGAREML DELMLHGHET CIKDMEKLRV  180
DMDKEAEKKS SSSKVVDLRM LLIDSQQCAG QVLKKIRQHS SATGDAMQRV AHCFAKGLEA  240
RLDGSGRQLY QSRWRMSLVE YLKVYKLYMS ACSFKKVALL FAAMTIMHAV QGKQKLHIVD  300
YGDCGLHWPD LFRRLGSREG GPPEVRITIV DIPQPGFRPA QRIEASGRCL SSCAKELGVP  360
FRFQAVAAAK WETVGADDLH IDPDEVLVVN DLLSFSVLMD ESVFSEGPSP RDVALRNIGR  420
MRADVVFIQG IANANHGASF LSRFRGALLY YSALFDMLDA TVPRGSELRL ALEQNILGPY  480
ALNAIACEGA DLVERPEKYR QWQARNHRAG MQQLPLRPEM LAAISDEVKR YHHKDFLLCE  540
DGQWLLQGWM GRVLFAHSAW VP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2920956022374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616386.10.0PREDICTED: scarecrow-like protein 9
TrEMBLJ3NAH60.0J3NAH6_ORYBR; Uncharacterized protein
STRINGOB11G28120.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-106GRAS family protein