PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB11G28110.1
Common NameLOC102707078
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 543aa    MW: 61338.9 Da    PI: 6.542
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB11G28110.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.21.9e-1011705402373
          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                    +lLl+cA+av ++  + a +lL++++++asp+gd++qRl ++f+++L+arl++++ + y++l++++ts   +++ l+a++lf  ++ + k+++  a
  OB11G28110.1 170 HTLLLHCAKAVVDE-RRSAAELLEQIRQHASPTGDAVQRLGHCFAKGLEARLSGTGIHAYRSLAATRTS---TADFLKAYQLFMSTCCFRKVAFTFA 262
                   679********985.667779*********************************999999999888888...8************************ PP

          GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                   N+aI +a++g +r+Hi+D+++ +G+QWp Llq L +R++gpp +RiT ++ p+sg   ++ +ee+g rL++ A+++gvpfef+++va +++++ +++
  OB11G28110.1 263 NKAIFNAAAGRSRLHIVDYGLHHGFQWPELLQWLGEREGGPPVVRITHIDLPQSGfrPAKHMEEMGTRLSRCAHQFGVPFEFRLIVAPQWQSVCVDD 359
                   ******************************************************9******************************999********* PP

          GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                   ++++p+E+l Vn  ++  +l+desv ++s  +rd vL+ + +++P+v+v+   + +h + +Fl rf eal y+sa+fd+l+a++pres+ r ++E+ 
  OB11G28110.1 360 INMEPDEVLTVNDLFNFRTLMDESVVIDSksPRDIVLSNIAKMRPDVFVHGTVNGSH-GITFLSRFREALFYHSAMFDMLDATMPRESQLRLVLEQD 455
                   ************************99988779*************************.789************************************ PP

          GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                   +lg+ + n++aceg++r+er et+++W+ r ++aG++++pl+ ++   +  +++k++ + + +ee++++l++gWk+r L++ S W
  OB11G28110.1 456 ILGWVALNAIACEGEDRVERGETYKQWQVRNQRAGLRQLPLNRETLVMVTNMVKKHYHKDFVIEEDQQWLLQGWKGRILFAHSTW 540
                   *********************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.937143521IPR005202Transcription factor GRAS
PfamPF035146.5E-99170540IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MAPHSPSHSE EQRHLLQLRR ILMEEEEDHA YGDHPALLHV QQPFAQILSS SSTSTSTSLL  60
PEDNNGVVSA NLLVNTDDYN PDMFRAAFFK GMDDAGKFLP TPPKEKAARG HGVEDELDVC  120
RAPTKVAGGE ADTNEMLDQM MLHGFAIPME EKASMNKCNK NKEAEAVDLH TLLLHCAKAV  180
VDERRSAAEL LEQIRQHASP TGDAVQRLGH CFAKGLEARL SGTGIHAYRS LAATRTSTAD  240
FLKAYQLFMS TCCFRKVAFT FANKAIFNAA AGRSRLHIVD YGLHHGFQWP ELLQWLGERE  300
GGPPVVRITH IDLPQSGFRP AKHMEEMGTR LSRCAHQFGV PFEFRLIVAP QWQSVCVDDI  360
NMEPDEVLTV NDLFNFRTLM DESVVIDSKS PRDIVLSNIA KMRPDVFVHG TVNGSHGITF  420
LSRFREALFY HSAMFDMLDA TMPRESQLRL VLEQDILGWV ALNAIACEGE DRVERGETYK  480
QWQVRNQRAG LRQLPLNRET LVMVTNMVKK HYHKDFVIEE DQQWLLQGWK GRILFAHSTW  540
VAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-401735408374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663691.10.0PREDICTED: scarecrow-like protein 14
TrEMBLJ3NAH50.0J3NAH5_ORYBR; Uncharacterized protein
STRINGOB11G28110.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-129SCARECROW-like 14